Clone Name | rbastl12h02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YAAU_ECOLI (P31679) Hypothetical metabolite transport protein yaaU | 29 | 3.7 | 2 | CXI_CONMI (P69498) I-superfamily conotoxin precursor | 28 | 4.8 | 3 | CXI2_CONVX (P69501) I-superfamily conotoxin-2 precursor | 28 | 4.8 |
---|
>YAAU_ECOLI (P31679) Hypothetical metabolite transport protein yaaU| Length = 443 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 Query: 214 EQVVEGLKLHGAWTWLFVCGTMSVLFVGLS 125 EQ+ LKL W L GT++ LFVG S Sbjct: 42 EQLTPALKLDADWIGLLGAGTLAGLFVGTS 71
>CXI_CONMI (P69498) I-superfamily conotoxin precursor| Length = 67 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 185 WCVDMVVCLWNHVCLVCRPILCVSKFKKTATFHD 84 +C + C W C CR + C +F K ATF + Sbjct: 35 YCTPYLPCCWGICCDTCRNV-CHLRFGKRATFQE 67
>CXI2_CONVX (P69501) I-superfamily conotoxin-2 precursor| Length = 67 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 185 WCVDMVVCLWNHVCLVCRPILCVSKFKKTATFHD 84 +C + C W C CR + C +F K ATF + Sbjct: 35 YCTPYLPCCWGICCDTCRNV-CHLRFGKRATFQE 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,720,031 Number of Sequences: 219361 Number of extensions: 655067 Number of successful extensions: 1360 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1359 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)