Clone Name | rbastl12g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SOAT2_HUMAN (O75908) Sterol O-acyltransferase 2 (EC 2.3.1.26) (C... | 28 | 4.6 | 2 | SOAT2_CERAE (O77759) Sterol O-acyltransferase 2 (EC 2.3.1.26) (C... | 28 | 4.6 | 3 | OST6_MOUSE (Q5GFD5) Heparan sulfate glucosamine 3-O-sulfotransfe... | 28 | 4.6 | 4 | OST4_HUMAN (Q9Y661) Heparan sulfate glucosamine 3-O-sulfotransfe... | 28 | 6.1 |
---|
>SOAT2_HUMAN (O75908) Sterol O-acyltransferase 2 (EC 2.3.1.26) (Cholesterol| acyltransferase 2) (Acyl coenzyme A:cholesterol acyltransferase 2) (ACAT-2) Length = 522 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 147 LSYVRYRCFLHGQSCIIFFLPESRVPFS 64 L V Y CF+ G+ C+ F SR PFS Sbjct: 305 LGCVLYACFILGRLCVPVFANMSREPFS 332
>SOAT2_CERAE (O77759) Sterol O-acyltransferase 2 (EC 2.3.1.26) (Cholesterol| acyltransferase 2) (Acyl coenzyme A:cholesterol acyltransferase 2) (ACAT-2) Length = 526 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 147 LSYVRYRCFLHGQSCIIFFLPESRVPFS 64 L V Y CF+ G+ C+ F SR PFS Sbjct: 309 LGCVLYACFILGRLCVPVFANMSREPFS 336
>OST6_MOUSE (Q5GFD5) Heparan sulfate glucosamine 3-O-sulfotransferase 6 (EC| 2.8.2.23) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 6) (Heparan sulfate 3-O-sulfotransferase 6) (3-OST-6) Length = 342 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 70 WYSGFWKEEYNTRLTMQEAPISNITKPAPPKMH 168 WY G + ++TM++ P +T+ AP ++H Sbjct: 136 WYRGLMPRTLDGQITMEKTPSYFVTQEAPRRIH 168
>OST4_HUMAN (Q9Y661) Heparan sulfate glucosamine 3-O-sulfotransferase 4 (EC| 2.8.2.23) (Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 4) (Heparan sulfate 3-O-sulfotransferase 4) (h3-OST-4) Length = 456 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 Query: 67 EWYSGFWKEEYNTRLTMQEAPISNITKPAPPKMH 168 EWY + + ++TM++ P +T AP ++H Sbjct: 242 EWYRNVMPKTLDGQITMEKTPSYFVTNEAPKRIH 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,378,381 Number of Sequences: 219361 Number of extensions: 739702 Number of successful extensions: 1677 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1677 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)