Clone Name | rbastl12g07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZEP1_MOUSE (Q03172) Zinc finger protein 40 (Transcription factor... | 31 | 0.92 | 2 | YCF2_VICFA (P15821) Protein ycf2 (Fragment) | 28 | 4.5 |
---|
>ZEP1_MOUSE (Q03172) Zinc finger protein 40 (Transcription factor alphaA-CRYBP1)| (Alpha A-crystallin-binding protein I) (Alpha A-CRYBP1) Length = 2688 Score = 30.8 bits (68), Expect = 0.92 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = -3 Query: 280 TSLPLYVNCLCWRPDAICTEVISSKSHQYFAQEKQLSQILLTATRG*SRRLQVTP 116 T LPL V+ +PDA T +SS FA + QL T+ +G S L+ +P Sbjct: 1513 TPLPLPVSAQGGKPDAAPTACVSSTGEGSFAPKYQLQCQAFTSDQGCSAPLRSSP 1567
>YCF2_VICFA (P15821) Protein ycf2 (Fragment)| Length = 121 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 205 SHQYFAQEKQLSQILLTATRG*SRRLQVTPWKLVQRVW 92 SHQ F+ ++++S+ILLT+ + Q WK + + W Sbjct: 8 SHQEFSPDEEMSRILLTS------QTQKIDWKYLNKPW 39 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,719,555 Number of Sequences: 219361 Number of extensions: 846053 Number of successful extensions: 2014 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1990 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2014 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)