Clone Name | rbastl12f12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CYC_SAMCY (P00037) Cytochrome c | 29 | 5.7 | 2 | DPOL_ADEG1 (Q64751) DNA polymerase (EC 2.7.7.7) | 28 | 7.4 | 3 | WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7... | 28 | 7.4 | 4 | CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (C... | 28 | 9.7 | 5 | UL09_HCMVA (P16745) Hypothetical protein UL9 precursor | 28 | 9.7 |
---|
>CYC_SAMCY (P00037) Cytochrome c| Length = 107 Score = 28.9 bits (63), Expect = 5.7 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = -3 Query: 429 HTVAANGGRHERVGPPTHDKVPSARHGYGGKQQGRSAGTEYSSRRQVGSLS*G 271 HTV A GG+H +VGP H G+ G++ G++ G YS+ + ++ G Sbjct: 22 HTVEA-GGKH-KVGPNLH--------GFYGRKTGQAPGFSYSNANKAKGITWG 64
>DPOL_ADEG1 (Q64751) DNA polymerase (EC 2.7.7.7)| Length = 1121 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 324 ICPVAFLHNHVWHLGLCRV*ADQLVHVFPHWQQLCA 431 + + LHN W + +V D++ VFP W+ LCA Sbjct: 602 VIDILTLHNRGWRV---QVLHDEMNIVFPEWKTLCA 634
>WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) (Kinase deficient protein) Length = 2382 Score = 28.5 bits (62), Expect = 7.4 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 Query: 239 HFTAHFKPIGQPQDKLPTCLLELYSV 316 H AHF P+GQP LPT LL Y V Sbjct: 819 HSGAHFLPVGQP---LPTPLLPQYPV 841
>CR2_MOUSE (P19070) Complement receptor type 2 precursor (Cr2) (Complement C3d| receptor) (CD21 antigen) Length = 1025 Score = 28.1 bits (61), Expect = 9.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 114 YFGKLSCDPSPESEKCRGSFATVYVV 37 YF ++SCDP PE + R + ++ +V Sbjct: 8 YFSEISCDPPPEVKNARKPYYSLPIV 33
>UL09_HCMVA (P16745) Hypothetical protein UL9 precursor| Length = 228 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 194 FSHLKPKLSQLDMICHFTAHFKPIGQPQDKLPTCLL 301 FS K L L+M+C++T + I D + C L Sbjct: 57 FSWYKDSLKALNMLCYYTEKLEEIDSKPDTIRRCFL 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,121,798 Number of Sequences: 219361 Number of extensions: 1253674 Number of successful extensions: 3105 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3105 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)