Clone Name | rbastl12f11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ENV_HV1Z8 (P05882) Envelope polyprotein GP160 precursor [Contain... | 28 | 7.9 |
---|
>ENV_HV1Z8 (P05882) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 863 Score = 27.7 bits (60), Expect = 7.9 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -1 Query: 251 ELLVCGIHCIQARTLCISTDINSIKKHYNILIVCSREHRHICQHAFPW 108 +L V GI +QAR L + S K +L + +HIC PW Sbjct: 574 QLTVWGIKQLQARVLAVE----SYLKDQQLLGIWGCSGKHICTTTVPW 617 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,364,294 Number of Sequences: 219361 Number of extensions: 648505 Number of successful extensions: 1219 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)