Clone Name | rbastl12f05 |
---|---|
Clone Library Name | barley_pub |
>GAG_EIAVY (P69732) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -1 Query: 325 PANGGANK--KQRKEPRCGKCSLTGHIRTQCGRGWESFFR*RGVYHF*KECRDI 170 P GGA K + C C GH+ +QC R + F+ + HF K+CR + Sbjct: 366 PFKGGALKGGPLKAAQTCYNCGKPGHLSSQC-RAPKVCFKCKQPGHFSKQCRSV 418
>GAG_EIAVC (P69731) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -1 Query: 325 PANGGANK--KQRKEPRCGKCSLTGHIRTQCGRGWESFFR*RGVYHF*KECRDI 170 P GGA K + C C GH+ +QC R + F+ + HF K+CR + Sbjct: 366 PFKGGALKGGPLKAAQTCYNCGKPGHLSSQC-RAPKVCFKCKQPGHFSKQCRSV 418
>GAG_EIAV9 (P69730) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 30.0 bits (66), Expect = 1.5 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -1 Query: 325 PANGGANK--KQRKEPRCGKCSLTGHIRTQCGRGWESFFR*RGVYHF*KECRDI 170 P GGA K + C C GH+ +QC R + F+ + HF K+CR + Sbjct: 366 PFKGGALKGGPLKAAQTCYNCGKPGHLSSQC-RAPKVCFKCKQPGHFSKQCRSV 418
>GAG_SIVV1 (P27972) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 520 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 316 GGANKKQRKEPRCGKCSLTGHIRTQC 239 GG + R P+C C GH++ QC Sbjct: 388 GGGRGRPRPPPKCYNCGKFGHMQRQC 413
>POL_HV2D2 (P15833) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1464 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -1 Query: 313 GANKKQRKEPR---CGKCSLTGHIRTQCGRGWESFFR*R 206 G +Q + PR C KC TGHI ++C F R R Sbjct: 396 GHTARQCRAPRRQGCWKCGKTGHIMSKCPERQAGFLRVR 434
>DHX15_MOUSE (O35286) Putative pre-mRNA-splicing factor ATP-dependent RNA| helicase DHX15 (EC 3.6.1.-) (DEAH box protein 15) Length = 795 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 240 AAVDGNHSFDDEVCIIFKKNAETLSQCHDNAVN 142 A +DG+H V FK+N E++ C+DN +N Sbjct: 618 AHIDGDHLTLLNVYHAFKQNHESVQWCYDNFIN 650
>DHX15_HUMAN (O43143) Putative pre-mRNA-splicing factor ATP-dependent RNA| helicase DHX15 (EC 3.6.1.-) (DEAH box protein 15) (ATP-dependent RNA helicase #46) Length = 795 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 240 AAVDGNHSFDDEVCIIFKKNAETLSQCHDNAVN 142 A +DG+H V FK+N E++ C+DN +N Sbjct: 618 AHIDGDHLTLLNVYHAFKQNHESVQWCYDNFIN 650
>AIR2_YEAST (Q12476) Protein AIR2 (Arginine methyltransferase-interacting RING| finger protein 2) Length = 344 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 292 KEPRCGKCSLTGHIRTQCGRGWE 224 K +C KC GH R+QC W+ Sbjct: 97 KAIQCSKCDEVGHYRSQCPHKWK 119
>GAG_MMTVC (P11284) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 331 KSPANGGANKKQRKEPRCGKCSLTGHIRTQC 239 K GG + K P C C TGHI+ C Sbjct: 509 KQTYGGGKGGQGSKGPVCFSCGKTGHIKRDC 539
>POL_HV2G1 (P18042) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 313 GANKKQRKEPR---CGKCSLTGHIRTQCGRGWESFFR 212 G + +Q + PR C KC TGH+ +C F R Sbjct: 398 GHSARQCRAPRRQGCWKCGKTGHVMAKCPERQAGFLR 434
>GAG_SIVVT (P05892) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 519 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 313 GANKKQRKEPRCGKCSLTGHIRTQC 239 G K+QR RC C GH++ QC Sbjct: 388 GGPKRQRPPLRCYNCGKFGHMQRQC 412
>DEVR_MYXXA (Q07765) Fruiting body developmental protein R| Length = 302 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 323 SKRGSKQEAEEGT-QVR*VQLDRTHQDSMRPWMG 225 S G+KQE E+GT +VR L+ + S+ PW G Sbjct: 102 SAEGAKQEKEKGTAKVRRAVLEVSRAVSLTPWSG 135
>GAG_MMTVB (P10258) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 331 KSPANGGANKKQRKEPRCGKCSLTGHIRTQC 239 K GG + + P C C TGHIR C Sbjct: 509 KQTYGGGKGGQGAEGPVCFSCGKTGHIRKDC 539
>EXG_KLULA (Q12628) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 429 Score = 27.7 bits (60), Expect = 7.4 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -2 Query: 219 SFDDEVCIIFKKNAETLSQCHDNAVNDW 136 + D+ + ++ ++ ETL++ H N V +W Sbjct: 290 TIDEHISVVCEQGKETLTEAHWNVVGEW 317
>GAG_SIVS4 (P12496) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 507 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 313 GANKKQRKEPR---CGKCSLTGHIRTQC 239 G + KQ + PR C KC TGH+ +C Sbjct: 401 GHSAKQCRAPRRQGCWKCGKTGHVMAKC 428
>NU2M_MYXGL (O21078) NADH-ubiquinone oxidoreductase chain 2 (EC 1.6.5.3) (NADH| dehydrogenase subunit 2) Length = 348 Score = 27.7 bits (60), Expect = 7.4 Identities = 24/91 (26%), Positives = 39/91 (42%), Gaps = 1/91 (1%) Frame = -3 Query: 272 VQLDRTH-QDSMRPWMGIILSMTRCVSFLKRMQRHYLNVMIMLLTIGGIKPFVQTIM*FS 96 ++L+ T D M W S T+C+ ++LL++GG+ PF + S Sbjct: 218 IELNSTKISDLMLSWSKTSWSHTKCI--------------LVLLSLGGLPPFTGFFLKLS 263 Query: 95 VDKCMHAYEGSLICWYLILRICILWHGGLVS 3 + +LI LIL +L G L+S Sbjct: 264 I-------SNALISNSLILMTILLMAGSLIS 287
>YEW7_YEAST (P40083) Hypothetical 16.6 kDa protein in GDI1-COX15 intergenic| region Length = 148 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 310 ANKKQRKEPRCGKCSLTGHIRTQCG 236 ++KK++ + +C C GH R CG Sbjct: 115 SSKKKKNKIKCSFCHEAGHTRAHCG 139
>MAB3_CAEEL (O18214) Protein male abnormal 3| Length = 290 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 7/37 (18%) Frame = -1 Query: 328 SPANGGANKKQRKEPRCGKCS-------LTGHIRTQC 239 +PA + K+ ++P C +CS L GH RT C Sbjct: 78 TPATQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMC 114
>POLG_HCVED (O39929) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3007 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 53 WYLILRICILWH 18 WY IL ICI+WH Sbjct: 765 WYAILFICIVWH 776
>AIR1_YEAST (P40507) Protein AIR1 (Arginine methyltransferase-interacting RING| finger protein 1) Length = 360 Score = 27.3 bits (59), Expect = 9.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -1 Query: 280 CGKCSLTGHIRTQCGRGWESFF 215 C C+ GH ++QC W+ F Sbjct: 114 CTNCNANGHYKSQCPHKWKKVF 135 Score = 27.3 bits (59), Expect = 9.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 289 EPRCGKCSLTGHIRTQC 239 EP+C CS GH++ C Sbjct: 73 EPKCNNCSQRGHLKRNC 89 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,879,770 Number of Sequences: 219361 Number of extensions: 982591 Number of successful extensions: 2280 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 2208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2280 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)