Clone Name | rbastl12f01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MSRB2_HUMAN (Q9Y3D2) Methionine-R-sulfoxide reductase B2 (EC 1.8... | 30 | 1.2 | 2 | OPGD_XANCP (Q8P3C6) Glucans biosynthesis protein D precursor | 30 | 1.6 | 3 | DYH11_HUMAN (Q96DT5) Ciliary dynein heavy chain 11 (Axonemal bet... | 28 | 6.0 |
---|
>MSRB2_HUMAN (Q9Y3D2) Methionine-R-sulfoxide reductase B2 (EC 1.8.4.-)| Length = 201 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 115 RASPSSKRHSRFLWMVEQLVLEVGPERFILG 207 RA+ +RH R LW++ L L P R + G Sbjct: 12 RAAAPERRHGRLLWLLRGLTLGTAPRRAVRG 42
>OPGD_XANCP (Q8P3C6) Glucans biosynthesis protein D precursor| Length = 533 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +2 Query: 86 GKNDRKKDWIELVPQASVTVGFSGWL--SSWFWRSVLN 193 G+NDR+ DW + P+ T G + W W WR + N Sbjct: 275 GENDRRMDW-DWRPEIHDTDGLAMWTGGGEWIWRPLCN 311
>DYH11_HUMAN (Q96DT5) Ciliary dynein heavy chain 11 (Axonemal beta dynein heavy| chain 11) Length = 4523 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 2 KIMIFFSPVGRTVCFAS*IKVKLTQTPKGKNDRKKDWIELVPQASV 139 KI++ FSPVGRT ++V+ + P N DW PQ ++ Sbjct: 2987 KIILCFSPVGRT------LRVRARKFPAIVNCTAIDWFHAWPQEAL 3026 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,889,196 Number of Sequences: 219361 Number of extensions: 778918 Number of successful extensions: 2072 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2071 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)