Clone Name | rbastl12e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VD05_VARV (P33069) Protein D5 | 28 | 7.6 | 2 | SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat... | 27 | 10.0 |
---|
>VD05_VARV (P33069) Protein D5| Length = 785 Score = 27.7 bits (60), Expect = 7.6 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = +1 Query: 130 NLEENNNKIASCAKLDYYYYCSTLEQLYS*VQ*T*HLHPHQYLVEDDAV*SVSRISYDHS 309 +L+ENN +DY C+ ++ H HPHQ +E+DA+ + + HS Sbjct: 263 DLDENNFTTVPLV-IDYVTPCALCKKRS-------HKHPHQLSLENDAI-RIYKTGNPHS 313 Query: 310 C 312 C Sbjct: 314 C 314
>SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat protein 2)| (Syne-2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein) Length = 6885 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 83 DCVGSDASQE*QRIQEIWKKITTKSLPALN 172 D VGS S+E +R+ + W+K+ +K+ +N Sbjct: 641 DVVGSSISKELRRLNKRWRKLVSKTQLEMN 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,650,027 Number of Sequences: 219361 Number of extensions: 635366 Number of successful extensions: 1392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1392 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)