ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl12e04 |
|---|---|
| Clone Library Name | barley_pub |
>DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 209 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 150 IEGCSSIYARFGIGSKEIHLLLSVWVYM*PISAREN*MLQYHKK 19 IEGC S+ + G+ + +H+ L+ W+Y A +YH++ Sbjct: 98 IEGCLSVPGKVGVVERYVHVELTAWLYHSDTEALSKIKREYHRE 141
>SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 289 Score = 29.6 bits (65), Expect = 2.0 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +1 Query: 19 FFMILQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 150 F +Q S PG +R +HPNR Q KPS D LY Sbjct: 52 FIAYVQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQDLY 95
>S4A7_RAT (Q9R1N3) Sodium bicarbonate cotransporter 3 (Electroneutral sodium| bicarbonate cotransporter 1) (NBC-like protein) (Solute carrier family 4 member 7) Length = 1218 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 216 HIPHISLTELDERCWRHEISLRW 284 HIPH TE+DE C+R W Sbjct: 112 HIPHDLFTEMDELCYRDGEEYEW 134
>S4A7_MOUSE (Q8BTY2) Sodium bicarbonate cotransporter 3 (Solute carrier family| 4 member 7) Length = 1034 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 216 HIPHISLTELDERCWRHEISLRW 284 HIPH TE+DE C+R W Sbjct: 112 HIPHDLFTEMDELCYRDGEEYEW 134
>S4A7_HUMAN (Q9Y6M7) Sodium bicarbonate cotransporter 3 (Sodium bicarbonate| cotransporter 2) (Sodium bicarbonate cotransporter 2b) (Bicarbonate transporter) (Solute carrier family 4 member 7) Length = 1214 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 216 HIPHISLTELDERCWRHEISLRW 284 HIPH TE+DE C+R W Sbjct: 107 HIPHDLFTEMDELCYRDGEEYEW 129
>YDCO_ECOLI (P76103) Inner membrane protein ydcO| Length = 391 Score = 28.5 bits (62), Expect = 4.4 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = -2 Query: 270 SHDASIARPIQLS*YAECVYGYLLSTKAAGRSAPVFVLVFIEG-CSSIYARFGIGS 106 +H S+A P+ L A + + KAAG SAPV L+ G + +++ FG+ S Sbjct: 209 AHSLSVALPLFLVTMASQNAPGIAAMKAAGYSAPVSPLIVFTGLLALVFSPFGVYS 264
>SYGA_RICCN (Q92G10) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 288 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +1 Query: 31 LQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 150 +Q S PG +R +HPNR Q KPS D LY Sbjct: 56 VQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQELY 95
>PRIA_CHLMU (Q9PLE5) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 753 Score = 28.1 bits (61), Expect = 5.8 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = -1 Query: 322 STNERLSVGEQLL---HRSEIS*RQHRSSNSVKLICGMCIWVLAIHKSGREICSSLC 161 S +RL+VGEQ + +R SS L C C +L HK+ R + LC Sbjct: 432 SIEQRLAVGEQTIIFFNRRGFHTNVSCSSCKYTLKCPHCDMILTFHKTERILLCHLC 488
>SEPT3_MOUSE (Q9Z1S5) Neuronal-specific septin-3| Length = 465 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = -1 Query: 217 CIWVLAIHKSGREICSSLCACIYRGMLIYLCSVW 116 C++V + + +C + C+Y G+ + C +W Sbjct: 393 CVYVCVMESACVCVCMCVYVCVYSGVRYFHCPLW 426
>NAPA_AGRT5 (Q8U7P1) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 833 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 44 WSKAPCRFCG 53
>NAPA_RHOS4 (Q53176) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 831 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 43 WSKAPCRFCG 52
>NAPA_RALEU (P39185) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 831 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 43 WSKAPCRFCG 52
>NAPA_RALEJ (Q46RX3) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 831 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 43 WSKAPCRFCG 52
>NAPA_PARPN (Q56350) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 831 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 43 WSKAPCRFCG 52
>NAPA_BORPA (Q7W733) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 831 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 43 WSKAPCRFCG 52
>NAPA_BORBR (Q7WIQ1) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 829 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 41 WSKAPCRFCG 50
>CHK1_YEAST (P38147) Serine/threonine-protein kinase CHK1 (EC 2.7.11.1)| (Checkpoint kinase 1) Length = 527 Score = 27.7 bits (60), Expect = 7.5 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +2 Query: 29 YCNIQFSLAEIGYI-YTQ--TDNNRWISLLPIPNRA*IDEHPSINTSTKTGADLPAAFVD 199 + +++ SL+ Y+ +TQ NNR+IS PI N EH S++ T + D Sbjct: 305 FSHLKVSLSNENYLKFTQDTNSNNRYISTQPIGNELAELEHDSMHFQTVSNTQRAFTSYD 364 Query: 200 SKYPY 214 S Y Sbjct: 365 SNTNY 369
>PRIA_CHLTR (O84783) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 753 Score = 27.7 bits (60), Expect = 7.5 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -1 Query: 322 STNERLSVGEQLL---HRSEIS*RQHRSSNSVKLICGMCIWVLAIHKSGREICSSLC 161 S +RL VGEQ + +R SS L C C +L HK+ R + LC Sbjct: 432 SIEQRLEVGEQTIIFFNRRGFHTNVSCSSCKYTLKCPHCDMILTFHKTERILLCHLC 488
>NAPA_RHIME (Q92Z36) Periplasmic nitrate reductase precursor (EC 1.7.99.4)| Length = 834 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 Query: 169 WSRSPCRFCG 198 WS++PCRFCG Sbjct: 45 WSKAPCRFCG 54
>ETHE1_MOUSE (Q9DCM0) ETHE1 protein, mitochondrial precursor (EC 3.-.-.-)| (Ethylmalonic encephalopathy protein 1 homolog) (Hepatoma subtracted clone one protein) Length = 254 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 159 AQRLEQISLPLLWIASTHIHIPHISLT 239 AQ ++++ L LL+ +TH H HI+ T Sbjct: 62 AQLIKELGLKLLYAVNTHCHADHITGT 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,436,744 Number of Sequences: 219361 Number of extensions: 918905 Number of successful extensions: 2073 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 2023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2071 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
