Clone Name | rbastl12e03 |
---|---|
Clone Library Name | barley_pub |
>VPS18_MOUSE (Q8R307) Vacuolar protein sorting 18| Length = 973 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 217 PTRTHFTLCNCVAVCSHLSHHRAC-HIH 297 P R H+ L + +C+ HHRAC H++ Sbjct: 690 PHRVHYDLKYALRLCAEHGHHRACVHVY 717
>VPS18_HUMAN (Q9P253) Vacuolar protein sorting 18 (hVPS18)| Length = 973 Score = 28.5 bits (62), Expect = 4.3 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 217 PTRTHFTLCNCVAVCSHLSHHRAC-HIH 297 P R H+ L + +C+ HHRAC H++ Sbjct: 690 PHRVHYDLKYALRLCAEHGHHRACVHVY 717
>UL04_HCMVA (P17146) Early glycoprotein GP48 precursor| Length = 152 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -1 Query: 102 VFGW*KPDICNFFPKESMNLRKKERRMQVLSI 7 + GW IC+FFPK N ++ R +V ++ Sbjct: 78 LLGWGHKSICSFFPKLQGNYNEQHYRYEVANL 109
>YEAE_SCHPO (O14079) Hypothetical protein UNK4.14 in chromosome I| Length = 520 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Frame = -2 Query: 230 CVRVGKIVDGRP---KVAPREANWMFKVVD*HFHLCAN 126 C++ GK++D R K EA W F++ D H C N Sbjct: 350 CIKSGKVLDFRSYKYKDEEAEAKWGFRLDDIHRRTCFN 387
>LRP2_HUMAN (P98164) Low-density lipoprotein receptor-related protein 2 precursor| (Megalin) (Glycoprotein 330) (gp330) Length = 4655 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 313 CRPHLRGCDKHDDEKGDYKQRRSC 242 C P + CD+H+D GDY R C Sbjct: 3005 CIPKIFRCDRHND-CGDYSDERGC 3027
>RUVB_PROMP (Q7UZP3) Holliday junction ATP-dependent DNA helicase ruvB (EC| 3.6.1.-) Length = 352 Score = 27.3 bits (59), Expect = 9.5 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +1 Query: 157 TLNI-QFASLGATLGLPSTILPTRTHFTLCNCVAVCSHLSHHRACHIHADEVGRRCFHSG 333 T+N+ +F +GAT L S P R F LC+ + + S+ H+ A + + + Sbjct: 166 TINLPKFTLIGATTKLASISAPLRDRFGLCHKIELYSNDELHQIIFNFATLINLQLENDA 225 Query: 334 TTALS 348 +AL+ Sbjct: 226 CSALA 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,366,901 Number of Sequences: 219361 Number of extensions: 861594 Number of successful extensions: 1888 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1888 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)