Clone Name | rbastl12d12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2 | 32 | 0.52 | 2 | UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1 | 32 | 0.52 | 3 | UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3 | 30 | 1.5 | 4 | TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein | 27 | 9.7 | 5 | IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E... | 27 | 9.7 |
---|
>UBE12_WHEAT (P31251) Ubiquitin-activating enzyme E1 2| Length = 1051 Score = 31.6 bits (70), Expect = 0.52 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 332 PSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 240 PSYRRHL DIPLVSVYFR Sbjct: 1021 PSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE11_WHEAT (P20973) Ubiquitin-activating enzyme E1 1| Length = 1051 Score = 31.6 bits (70), Expect = 0.52 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 332 PSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 240 PSYRRHL DIPLVSVYFR Sbjct: 1021 PSYRRHLDVVVACEDDDDNDVDIPLVSVYFR 1051
>UBE13_WHEAT (P31252) Ubiquitin-activating enzyme E1 3| Length = 1053 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 332 PSYRRHLXXXXXXXXXXXXXXDIPLVSVYFR 240 P YRRHL DIPLVSVYFR Sbjct: 1023 PEYRRHLDIGVACEDEDENDVDIPLVSVYFR 1053
>TX13B_HUMAN (Q9BXU2) Testis-expressed sequence 13B protein| Length = 312 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +1 Query: 94 HRDGRKENQSVMWLKPPLSLQSLMQLMTCQSIRHDQPQDHVNTDEALLQ 240 HR G+ +N+ V WL+ L L+ ++ + Q + +EA Q Sbjct: 80 HRQGQLQNRRVQWLQGFAKLHRSAALVLASNLTELKEQQEMECNEATFQ 128
>IF4E2_ARATH (O04663) Eukaryotic translation initiation factor 4E-2 (eIF4E-2)| (eIF-4E-2) (mRNA cap-binding protein) (eIF-(iso)4F 25 kDa subunit) (eIF-(iso)4F p28 subunit) (eIF4Eiso protein) (eIF(iso)4E) Length = 198 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 86 DHWGLIWSCYQTSRFTRHAQHHL 18 D WGL + +QTS+ T +A+ HL Sbjct: 61 DFWGLHETIFQTSKLTANAEIHL 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,915,384 Number of Sequences: 219361 Number of extensions: 728053 Number of successful extensions: 1381 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1381 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)