| Clone Name | rbastl12c05 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 62.0 bits (149), Expect = 3e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSGAAYVLFYRGVTKADG 245 +RWYNFDDSH+S INE++VKSGAAYVLFYR + A G Sbjct: 885 SRWYNFDDSHISHINEDDVKSGAAYVLFYRRKSDAGG 921
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/29 (55%), Positives = 24/29 (82%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +W+ FDD+ VS +NE +++S AAYVLFY+ Sbjct: 857 QWHYFDDNSVSPVNENQIESKAAYVLFYQ 885
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +WY FDDS VS +E+++ S AAYVLFY+ Sbjct: 903 KWYYFDDSSVSTASEDQIVSKAAYVLFYQ 931
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +WY FDDS VS +E+++ S AAYVLFY+ Sbjct: 903 KWYYFDDSSVSTASEDQIVSKAAYVLFYQ 931
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 40.8 bits (94), Expect = 8e-04 Identities = 16/29 (55%), Positives = 24/29 (82%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +WY FDDS+VS +E+++ + AAYVLFY+ Sbjct: 893 KWYYFDDSNVSLASEDQIVTKAAYVLFYQ 921
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 RW+ FDD VS I+ VKS AAY+LFY Sbjct: 1079 RWFKFDDHEVSDISVSSVKSSAAYILFY 1106
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 40.4 bits (93), Expect = 0.001 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 N WY FDD V+ ++E V++ AYVLFYR Sbjct: 684 NLWYEFDDQSVTEVSESTVQNAEAYVLFYR 713
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +WY FDDS VS +E+++ + AAYVLFY+ Sbjct: 892 KWYYFDDSSVSLASEDQIVTKAAYVLFYQ 920
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 39.3 bits (90), Expect = 0.002 Identities = 15/29 (51%), Positives = 23/29 (79%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +W+ DD+ VS +NE +++S AAYVLFY+ Sbjct: 735 QWHYLDDNSVSPVNENQIESKAAYVLFYQ 763
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 RW+ FDD VS I+ V+S AAY+LFY Sbjct: 1041 RWFKFDDHEVSDISVSSVRSSAAYILFY 1068
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/29 (48%), Positives = 21/29 (72%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYR 266 +WY FDD +V+ ++E V++ YVLFYR Sbjct: 654 QWYEFDDQYVTEVHETVVQNAEGYVLFYR 682
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 37.4 bits (85), Expect = 0.009 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSGAAYVLFY-RGVTKADGAASNGTQSCVK 212 N+WY FDDS V+ E +G+AY+LFY R +G S+ Q ++ Sbjct: 1079 NKWYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDGNGLGSSKLQEIIQ 1127
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 +W+ F+DS VS+I++EEV AY+LFY Sbjct: 438 QWFKFNDSMVSSISQEEVLKEQAYLLFY 465
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 RW++F+DS V+ +EE V AY+LFY Sbjct: 481 RWFHFNDSTVTVTDEETVGKAKAYILFY 508
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 35.4 bits (80), Expect = 0.035 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 RW++F+DS V+ +EE V AY+LFY Sbjct: 482 RWFHFNDSTVTLTDEETVVKAKAYILFY 509
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 35.0 bits (79), Expect = 0.045 Identities = 16/32 (50%), Positives = 22/32 (68%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYRGVT 257 ++Y FDDS V+ + EE + AAY+LFYR T Sbjct: 947 QFYCFDDSRVTPVCPEETVTSAAYLLFYRRKT 978
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 34.7 bits (78), Expect = 0.059 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFYR 266 W FDDS V+ ++E +V + AYVLFYR Sbjct: 1238 WRLFDDSTVTTVDESQVVTRYAYVLFYR 1265
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 34.7 bits (78), Expect = 0.059 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = -1 Query: 340 FDDSHVSAINEEEVKSGAAYVLFYR 266 FDD+ VS + E +++S AAYVLFY+ Sbjct: 386 FDDNSVSPVTENQIESKAAYVLFYQ 410
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 34.3 bits (77), Expect = 0.078 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFYR 266 W+ ++DS VS ++E +V S YVLFY+ Sbjct: 529 WHVYNDSRVSPVSENQVASSEGYVLFYQ 556
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 34.3 bits (77), Expect = 0.078 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFYR 266 W+ ++DS VS ++E +V S YVLFY+ Sbjct: 530 WHVYNDSRVSPVSENQVASSEGYVLFYQ 557
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSGAAYVLFY 269 + W++F+DS V+ ++ V+S AY+LFY Sbjct: 320 SEWHSFNDSRVTPMSSSHVRSSDAYLLFY 348
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVK 296 +WY+FDD HVS I +E++K Sbjct: 515 QWYSFDDQHVSRITQEDIK 533
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFYRGV 260 WYN D++V ++ E+V AY+LFY + Sbjct: 928 WYNVSDAYVRQVSLEKVLHSEAYILFYERI 957
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSGAAYVLFY 269 N+W+ DD+ + + E EV + AY+LFY Sbjct: 404 NQWFLLDDTTIVEVKESEVLNSQAYLLFY 432
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFYR 266 ++ FDD+ + I+ E++ + +AYVLFYR Sbjct: 819 FFKFDDTAICEIDPEDIVTSSAYVLFYR 846
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 32.0 bits (71), Expect = 0.38 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 +WY ++DS ++ +E+ + +AY+LFY Sbjct: 1339 KWYCYNDSSCEELHPDEIDTDSAYILFY 1366
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFY 269 W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 318 WHTFNDSSVTPMSSSQVRTSDAYLLFY 344
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 32.0 bits (71), Expect = 0.38 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 7/38 (18%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEV-------KSGAAYVLFYRG 263 N+WY F+D VS + +E++ +S +A +L Y+G Sbjct: 459 NKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMYKG 496
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFY 269 W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 570 WHTFNDSSVTPMSSSQVRTSDAYLLFY 596
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 32.0 bits (71), Expect = 0.38 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFYRGV 260 +W++ D+HV A+ +V + AY+LFY + Sbjct: 792 QWFHISDTHVQAVPTTKVLNSQAYLLFYERI 822
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 32.0 bits (71), Expect = 0.38 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 +WY ++DS ++ +E+ + +AY+LFY Sbjct: 1537 KWYCYNDSSCKELHPDEIDTDSAYILFY 1564
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 31.6 bits (70), Expect = 0.50 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVK 296 ++WY+F+D HVS I +E++K Sbjct: 514 DQWYSFNDQHVSRITQEDIK 533
>UBP1_ARATH (Q9FPT5) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) (AtUBP1) Length = 1083 Score = 30.8 bits (68), Expect = 0.86 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFYRGV 260 WY+ DS V + EEV AY+LFY + Sbjct: 1054 WYHASDSQVRPASLEEVLRSEAYILFYERI 1083
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 30.4 bits (67), Expect = 1.1 Identities = 9/27 (33%), Positives = 17/27 (62%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFY 269 WY F+D++ + + + + AY+LFY Sbjct: 433 WYEFNDTYTGKVTDNHIVNQNAYILFY 459
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 30.0 bits (66), Expect = 1.5 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 7/37 (18%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKS-------GAAYVLFYR 266 N+WY F+D+ VS + E V + AYVLFYR Sbjct: 887 NQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYR 923
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 349 WYNFDDSHVSAINEEEVKSGAAYVLFY 269 WY +DS VS + V S AYVLFY Sbjct: 383 WYQMNDSIVSTSDIRSVLSQQAYVLFY 409
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 29.3 bits (64), Expect = 2.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 +WY +DS V + N + V + AYVLFY Sbjct: 393 QWYQMNDSLVHSSNVKVVLNQQAYVLFY 420
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEVKSGAAYVLFY 269 +WY DD+ V+ + V + AYVLFY Sbjct: 318 KWYKMDDTKVTRCDVTSVLNENAYVLFY 345
>CA036_HUMAN (Q7Z3Z2) Protein C1orf36| Length = 195 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 132 KRNQKGSSKIAKVCNNSDYLWLDLRLRFTHDWVPL 236 ++ ++ S+ + KVC DY WL R T+D P+ Sbjct: 42 RQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPI 76
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 8/38 (21%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSG--------AAYVLFYR 266 N+WY DD +++ + +++V G AY+L Y+ Sbjct: 872 NKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQ 909
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = -1 Query: 349 WYNFDDSHVSAINE--------EEVKSGAAYVLFYRGVTKADGAAS 236 W FDD +V+ +NE ++ AYVLFY + D S Sbjct: 387 WVLFDDENVTPVNENYLQRFFGDQPGQATAYVLFYTAADEEDDDVS 432
>TXVE_BOTJA (Q90X23) Vascular endothelial growth factor toxin precursor| (svVEGF) Length = 146 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 56 SHLFRPSCITAISYG 100 SH+FRPSC+TA+ G Sbjct: 56 SHIFRPSCVTALRCG 70
>TXVE_BOTIN (Q90X24) Vascular endothelial growth factor toxin precursor| (svVEGF) Length = 146 Score = 28.5 bits (62), Expect = 4.3 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 56 SHLFRPSCITAISYG 100 SH+FRPSC+TA+ G Sbjct: 56 SHIFRPSCVTALRCG 70
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 7/35 (20%) Frame = -1 Query: 352 RWYNFDDSHVSAINEEEV--KSG-----AAYVLFY 269 +W FDD HV+ ++EE + SG +AYVL Y Sbjct: 421 KWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLY 455
>DISI_AGKCO (Q9IAB0) Zinc metalloproteinase contortrostatin precursor (EC| 3.4.24.-) [Contains: Disintegrin contortrostatin] Length = 483 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 113 VSV*DHRILRLYNLDGKGVRNTIRSWLHE 27 V V DHR+ YN G NTIR W+HE Sbjct: 203 VVVADHRMFTKYN----GNLNTIRIWVHE 227
>DISB_AGKPI (Q805F4) Zinc metalloproteinase piscivostatin-beta precursor (EC| 3.4.24.-) [Contains: Disintegrin piscivostatin-beta] Length = 483 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 113 VSV*DHRILRLYNLDGKGVRNTIRSWLHE 27 V V DHR+ YN G NTIR W+HE Sbjct: 203 VVVADHRMFTKYN----GNLNTIRIWVHE 227
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEVKSGAAYVLFYRGV 260 N+W D V + +EV S +AY+LFY V Sbjct: 471 NQWLWVSDDTVRKASLQEVLSSSAYLLFYERV 502
>CAC1B_DISOM (P56698) Probable voltage-dependent N-type calcium channel alpha-1B| subunit (Voltage-gated calcium channel alpha subunit Cav2.2) (DOE-4) Length = 2326 Score = 27.7 bits (60), Expect = 7.3 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 53 SSHLFRPSCITAISYGLTPKPCNSTHKKEPKGFF*NCEGMQQLRL 187 SSH RP T + L +P NST K K +C+ +Q RL Sbjct: 792 SSHQIRPDMKTHLDRPLVVEPRNSTRKSADKVCPSDCQEGEQERL 836
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEV----KSGAAYVLFYRGV 260 N W DD V IN+ +V AY+L+YR V Sbjct: 754 NGWLRIDDQTVKVINQYQVVKPPADRTAYLLYYRRV 789
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 6/38 (15%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEE------EVKSGAAYVLFYRGV 260 ++WY FDD V A + ++ S YVLFY V Sbjct: 1032 SKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERV 1069
>TXVE_BOTER (Q6J936) Vascular endothelial growth factor toxin precursor| (svVEGF) Length = 146 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +2 Query: 56 SHLFRPSCITAISYG 100 +H+FRPSC+TA+ G Sbjct: 56 AHIFRPSCVTALRCG 70
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = -1 Query: 355 NRWYNFDDSHVSAINEEEV----KSGAAYVLFYRGV 260 N W DD V IN+ +V AY+L+YR V Sbjct: 760 NGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRV 795 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,647,005 Number of Sequences: 219361 Number of extensions: 1024212 Number of successful extensions: 3440 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 3392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3440 length of database: 80,573,946 effective HSP length: 93 effective length of database: 60,173,373 effective search space used: 1444160952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)