| Clone Name | rbastl12b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PER45_ARATH (Q96522) Peroxidase 45 precursor (EC 1.11.1.7) (Atpe... | 32 | 0.30 | 2 | ALR3_RHILO (Q981H7) Alanine racemase 3 (EC 5.1.1.1) | 29 | 3.3 | 3 | ALR1_RHILO (Q98A05) Alanine racemase, biosynthetic (EC 5.1.1.1) | 28 | 4.4 | 4 | REXO3_CANGA (Q6FIU7) RNA exonuclease 3 (EC 3.1.-.-) | 28 | 4.4 | 5 | ECM18_YEAST (Q04623) Extracellular matrix protein 18 | 28 | 7.4 | 6 | ATC5_YEAST (P32660) Probable phospholipid-transporting ATPase DN... | 27 | 9.7 |
|---|
>PER45_ARATH (Q96522) Peroxidase 45 precursor (EC 1.11.1.7) (Atperox P45)| (ATP8a) Length = 325 Score = 32.3 bits (72), Expect = 0.30 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +1 Query: 1 KNTNKQFFLNFCIRHRNETCISISMYTKFSSIQTPNLRVILPTQSRNRAYPPNQKTFLT 177 KNT++ F NF + +C+S + T F PN+ I+ RN Q+TF+T Sbjct: 3 KNTSQTIFSNFFLLLLLSSCVSAQLRTGFYQNSCPNVETIV----RNAVRQKFQQTFVT 57
>ALR3_RHILO (Q981H7) Alanine racemase 3 (EC 5.1.1.1)| Length = 388 Score = 28.9 bits (63), Expect = 3.3 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 8 QTSNFS*TSVSGIGTKHASPFQCTQNSVRFRLQIYESFFLHRVEIEPI 151 +T S +++GIG KH P+ C N + R Y + + RV +E I Sbjct: 261 RTGRASRLAIAGIGYKHGLPWACA-NKISVRFAGYSAPLVGRVSMEYI 307
>ALR1_RHILO (Q98A05) Alanine racemase, biosynthetic (EC 5.1.1.1)| Length = 397 Score = 28.5 bits (62), Expect = 4.4 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 8 QTSNFS*TSVSGIGTKHASPFQCTQNSVRFRLQIYESFFLHRVEIE 145 +T S ++ GIG KH P+ C N + RL Y + + R+ +E Sbjct: 262 RTDRASRVAIVGIGYKHGLPWSCA-NKIFVRLAEYSAPSIGRISME 306
>REXO3_CANGA (Q6FIU7) RNA exonuclease 3 (EC 3.1.-.-)| Length = 398 Score = 28.5 bits (62), Expect = 4.4 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +2 Query: 119 FFLHRVEIEPIHPIRRHF*LFN----FSKQ*LMQSTSAELYPA*HQRESSTASVFYPLC 283 + L V+ EP P+ H FSK+ +M S + +P+ + ST YP C Sbjct: 133 YILPDVKYEPQQPVSSHVTCVRCGTKFSKEDIMNSVVCKFHPSKKLYDKSTKLEIYPCC 191
>ECM18_YEAST (Q04623) Extracellular matrix protein 18| Length = 453 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 53 KHASPFQCTQNSVRFRLQIYESFFLHRVE 139 K P+ N +F +Q+YE F+L R+E Sbjct: 191 KFKVPYTINANHNKFVIQMYEDFYLDRIE 219
>ATC5_YEAST (P32660) Probable phospholipid-transporting ATPase DNF1 (EC 3.6.3.1)| Length = 1571 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = +3 Query: 147 LSTQSEDIFNSSTLVSSNSCRVLLQSSIQPDIKGSRVRLQFSILSVFACCVGD 305 L+ EDI L+ N CR +L + P K + V+L L V +GD Sbjct: 1079 LALYGEDIRRKFLLLCKN-CRAVLCCRVSPSQKAAVVKLVKDSLDVMTLAIGD 1130 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,825,455 Number of Sequences: 219361 Number of extensions: 587259 Number of successful extensions: 1522 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1496 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1522 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)