| Clone Name | rbastl12b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | K125_TOBAC (O23826) 125 kDa kinesin-related protein | 60 | 1e-09 | 2 | K125_ARATH (P82266) Probable 125 kDa kinesin-related protein | 59 | 4e-09 | 3 | EAA3_CAEEL (Q21353) Putative sodium-dependent excitatory amino a... | 28 | 4.2 | 4 | PHF2_HUMAN (O75151) PHD finger protein 2 (GRC5) | 28 | 5.5 | 5 | PALA_SCHPO (Q09807) pH-response regulator protein palA/rim20 | 28 | 7.2 | 6 | YFGJ_ECOLI (P76575) Hypothetical protein yfgJ | 28 | 7.2 | 7 | YBV8_YEAST (P38266) Protein YBR108W | 27 | 9.4 | 8 | ATM_ARATH (Q9M3G7) Serine/threonine-protein kinase ATM (EC 2.7.1... | 27 | 9.4 |
|---|
>K125_TOBAC (O23826) 125 kDa kinesin-related protein| Length = 1006 Score = 60.1 bits (144), Expect = 1e-09 Identities = 31/47 (65%), Positives = 38/47 (80%), Gaps = 2/47 (4%) Frame = -1 Query: 362 KGTIESLRAMPIESLMDEFRENHPYES--SKEPKPSLIPRSPLATLN 228 K TIESLRAMP+E L++EFREN+ +ES KE KPSLIPRSP + +N Sbjct: 959 KVTIESLRAMPMEVLLEEFRENNSFESFQVKEVKPSLIPRSPFSQIN 1005
>K125_ARATH (P82266) Probable 125 kDa kinesin-related protein| Length = 1056 Score = 58.5 bits (140), Expect = 4e-09 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 2/46 (4%) Frame = -1 Query: 362 KGTIESLRAMPIESLMDEFRENHPYES--SKEPKPSLIPRSPLATL 231 K TIESLRAMPIE+L++EFREN+ YES +KE KP + RSPL+ L Sbjct: 963 KATIESLRAMPIETLVEEFRENNSYESFATKETKPQQLTRSPLSQL 1008
>EAA3_CAEEL (Q21353) Putative sodium-dependent excitatory amino acid| transporter glt-3 Length = 532 Score = 28.5 bits (62), Expect = 4.2 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 11/37 (29%) Frame = +3 Query: 246 RARDERRLG-----------FLARFIGMVLTELIHQG 323 RARD RR+G FLA F G++L IH G Sbjct: 70 RARDARRIGIVTIIYYMITTFLATFTGIILVSSIHPG 106
>PHF2_HUMAN (O75151) PHD finger protein 2 (GRC5)| Length = 1101 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 344 LRAMPIESLMDEFRENHPYESSKEPKPSLIPRSP 243 + A P +SL+++ + ++ K PKPS IP+ P Sbjct: 476 IEATPPQSLLEKVSKKKTPKTVKMPKPSKIPKPP 509
>PALA_SCHPO (Q09807) pH-response regulator protein palA/rim20| Length = 701 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/42 (28%), Positives = 28/42 (66%), Gaps = 6/42 (14%) Frame = +2 Query: 2 IHSSRNAKDTRHRIFYKNIRRLHNKL------IHSSKNAKDT 109 I+S +++++ + + FY ++ +LH ++ + +S+NAKDT Sbjct: 450 INSVKSSQNMKEKGFYSDVIKLHEEVSLLKVNVENSQNAKDT 491
>YFGJ_ECOLI (P76575) Hypothetical protein yfgJ| Length = 83 Score = 27.7 bits (60), Expect = 7.2 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = -1 Query: 206 LFCVQCNLIRTSNRCWL*CPCCARFYGMLALI-QCLLHSC*NVSICCGAAEYSCK 45 L C QC + + C C F M AL C H V CGA +Y C+ Sbjct: 15 LHCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDC--HQPLQVLKACGAVDYFCQ 67
>YBV8_YEAST (P38266) Protein YBR108W| Length = 947 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -1 Query: 350 ESLRAMPIESLMDEFRENHPYESSKEPKPSLIPRS 246 ++ +A P+E + E HP E + +PSL+P+S Sbjct: 603 QNSKASPVE-MKGEVLPGHPSEEDRNVEPSLVPQS 636
>ATM_ARATH (Q9M3G7) Serine/threonine-protein kinase ATM (EC 2.7.11.1) (Ataxia| telangiectasia mutated homolog) (AtATM) Length = 3856 Score = 27.3 bits (59), Expect = 9.4 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +2 Query: 11 SRNAKDTRHRIFYKNIRRLHNKLIHSSKNAKDTG*GLASHKTWHNKD 151 SR + R ++++ LHNKLI S + +DT G + W + D Sbjct: 2363 SRRSNYLPPRFLSRSLQALHNKLIASEVSQEDTN-GETAETFWQSDD 2408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,139,524 Number of Sequences: 219361 Number of extensions: 910103 Number of successful extensions: 2442 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2439 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)