Clone Name | rbastl12b06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HEMA_CVPIA (Q8JSP9) Hemagglutinin-esterase precursor (EC 3.1.1.5... | 28 | 8.3 | 2 | HEMA_CVP67 (Q8BB26) Hemagglutinin-esterase precursor (EC 3.1.1.5... | 28 | 8.3 |
---|
>HEMA_CVPIA (Q8JSP9) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 424 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 170 MANNILFFCYLYIHM*EERNLTMISVCGLYSKSLQPS 60 M N LF+ +Y M R+LT+++V +Y+ S QP+ Sbjct: 123 MQNKGLFYTQVYKKMAVYRSLTLVNVPYVYNGSAQPT 159
>HEMA_CVP67 (Q8BB26) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 424 Score = 27.7 bits (60), Expect = 8.3 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = -1 Query: 170 MANNILFFCYLYIHM*EERNLTMISVCGLYSKSLQPS 60 M N LF+ +Y M R+LT+++V +Y+ S QP+ Sbjct: 123 MQNKGLFYTQVYKKMAVYRSLTLVNVPYVYNGSAQPT 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,200,222 Number of Sequences: 219361 Number of extensions: 593163 Number of successful extensions: 1267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1267 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)