Clone Name | rbastl12b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | WFDC2_RAT (Q8CHN3) WAP four-disulfide core domain protein 2 prec... | 30 | 1.9 | 2 | VCAP_EHV1V (Q6S6S9) Major capsid protein (MCP) (Capsid protein VP5) | 28 | 7.3 | 3 | VCAP_EHV1B (P28920) Major capsid protein (MCP) (Capsid protein VP5) | 28 | 7.3 | 4 | RFC_SHIDY (Q03584) O-antigen polymerase | 27 | 9.5 |
---|
>WFDC2_RAT (Q8CHN3) WAP four-disulfide core domain protein 2 precursor| (Epididymal secretory protein 4) (RE4) Length = 168 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 208 GICFQLEPMVDVAS*FVCLLDCSCEASYR 122 G+C QLEP+ D C+LD C+ +Y+ Sbjct: 34 GVCPQLEPITDCVK--ACILDNDCQDNYK 60
>VCAP_EHV1V (Q6S6S9) Major capsid protein (MCP) (Capsid protein VP5)| Length = 1376 Score = 27.7 bits (60), Expect = 7.3 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 167 GGH-VHHRLKLKTNSGNQICHH*SSDLYVLGCSYATGLSPSLPVGYDCTVLARHD 328 GGH VH+R N N I H + VL Y + P+ G CT+ R+D Sbjct: 780 GGHLVHNRPIRGENKRNPIVPHHDPEWSVLSKIYYYAVVPAFSRGNCCTMGVRYD 834
>VCAP_EHV1B (P28920) Major capsid protein (MCP) (Capsid protein VP5)| Length = 1376 Score = 27.7 bits (60), Expect = 7.3 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 167 GGH-VHHRLKLKTNSGNQICHH*SSDLYVLGCSYATGLSPSLPVGYDCTVLARHD 328 GGH VH+R N N I H + VL Y + P+ G CT+ R+D Sbjct: 780 GGHLVHNRPIRGENKRNPIVPHHDPEWSVLSKIYYYAVVPAFSRGNCCTMGVRYD 834
>RFC_SHIDY (Q03584) O-antigen polymerase| Length = 380 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 272 GLSPSLPVGYDCTVLARHDN 331 GL SLP+ + C LARH+N Sbjct: 137 GLGISLPLSFCCMYLARHEN 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,402,353 Number of Sequences: 219361 Number of extensions: 861470 Number of successful extensions: 2001 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2000 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)