Clone Name | rbastl12b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LY86_HUMAN (O95711) Lymphocyte antigen 86 precursor (MD-1 protein) | 30 | 1.3 | 2 | CISY_SCHPO (Q10306) Probable citrate synthase, mitochondrial pre... | 30 | 1.7 | 3 | Y378_BORBU (O50165) Hypothetical protein BB0378 | 28 | 4.9 |
---|
>LY86_HUMAN (O95711) Lymphocyte antigen 86 precursor (MD-1 protein)| Length = 162 Score = 30.4 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -3 Query: 177 FLDIGVMIPSHSVFGPSYSVCEAFLPGLGPC 85 FLD+ +M SV SY +CEA LP C Sbjct: 82 FLDLALMSQGSSVLNFSYPICEAALPKFSFC 112
>CISY_SCHPO (Q10306) Probable citrate synthase, mitochondrial precursor (EC| 2.3.3.1) Length = 473 Score = 30.0 bits (66), Expect = 1.7 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = +1 Query: 67 KHDIGDTRSKSWKESFTYRIAWSKN*MTGYHHPYIQKLQTKYSAEK 204 K +IGD S+ +S+ +++ S + GY H ++K +Y+A++ Sbjct: 325 KKEIGDDLSEETIKSYLWKLLNSGRVVPGYGHAVLRKTDPRYTAQR 370
>Y378_BORBU (O50165) Hypothetical protein BB0378| Length = 220 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -3 Query: 216 SSQLFFRRVLCLQFLD-IGVMIPSHSVFGPSYSVCEAFLPGLGPCITDVVFV 64 + LFF L QF +GV + + FG +++ FLP P +++F+ Sbjct: 40 TQDLFFYERLKYQFFSGVGVNVSQNLAFGGEFNLDIKFLPSHTPYTNEIIFM 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,583,107 Number of Sequences: 219361 Number of extensions: 586742 Number of successful extensions: 1596 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1596 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)