Clone Name | rbastl12a02 |
---|---|
Clone Library Name | barley_pub |
>YZ2T_AGRVI (O34299) Hypothetical protein in TAR-II ttuC' 3'region (ORFZ2)| (Fragment) Length = 242 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 50 WGMPSSQFLGNLDLIQLKVQTEGIWI 127 WG+ +S ++GNL L+ L + G+W+ Sbjct: 97 WGIIASMWIGNLLLVILNLPLIGLWV 122
>DEMA_PONPY (Q5R4B6) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 125 SRCPQSEP*AELDPDFLETGNWACPMNLMIHSNKW 21 S+ P ++P P +ET W CP +L + +W Sbjct: 171 SKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEW 205
>DEMA_MOUSE (Q9WV69) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 125 SRCPQSEP*AELDPDFLETGNWACPMNLMIHSNKW 21 S+ P ++P P +ET W CP +L + +W Sbjct: 171 SKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEW 205
>DEMA_HUMAN (Q08495) Dematin (Erythrocyte membrane protein band 4.9)| Length = 405 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 125 SRCPQSEP*AELDPDFLETGNWACPMNLMIHSNKW 21 S+ P ++P P +ET W CP +L + +W Sbjct: 171 SKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEW 205
>YZ2R_AGRVI (P70795) Hypothetical 52.8 kDa protein in TAR-I ttuC' 3'region| (ORFZ2) Length = 502 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 50 WGMPSSQFLGNLDLIQLKVQTEGIWI 127 WG+ +S ++GNL L+ L + G+W+ Sbjct: 357 WGIIASMWIGNLLLVILNLPLIGLWV 382 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,415,432 Number of Sequences: 219361 Number of extensions: 540788 Number of successful extensions: 1231 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1231 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)