Clone Name | rbastl11g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DCE_LACLC (O30418) Glutamate decarboxylase (EC 4.1.1.15) | 28 | 5.4 | 2 | DCE_LACLA (Q9CG20) Glutamate decarboxylase (EC 4.1.1.15) (GAD) | 28 | 5.4 |
---|
>DCE_LACLC (O30418) Glutamate decarboxylase (EC 4.1.1.15)| Length = 466 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 27 IKRADNICEQFSVTTDRRILHHVDHSKINLY 119 IK DN+ E+++ TD ++ HVD + LY Sbjct: 221 IKALDNLIEEYNKQTDYKVYIHVDAASGGLY 251
>DCE_LACLA (Q9CG20) Glutamate decarboxylase (EC 4.1.1.15) (GAD)| Length = 466 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 27 IKRADNICEQFSVTTDRRILHHVDHSKINLY 119 IK DN+ E+++ TD ++ HVD + LY Sbjct: 221 IKALDNLIEEYNKQTDYKVYIHVDAASGGLY 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,229,626 Number of Sequences: 219361 Number of extensions: 213865 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)