Clone Name | rbastl11g05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYI_CHLAB (Q5L5L0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 34 | 0.077 | 2 | APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptida... | 32 | 0.38 | 3 | APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptida... | 30 | 1.9 | 4 | DFA1_SYNY3 (Q55393) Diflavin flavoprotein A 1 (EC 1.-.-.-) (SsAT... | 28 | 7.2 |
---|
>SYI_CHLAB (Q5L5L0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 1043 Score = 34.3 bits (77), Expect = 0.077 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Frame = -2 Query: 356 EVSQFFATRVKPSFERALKQSLERVRISARWIDSIKSEPSLAQT-VQQLLLQEF*AAPLY 180 E F T VKP+F +SL R R+ + D K+ SL+Q +QQLL QE+ + L Sbjct: 862 EAPSFVKTTVKPNF-----RSLGR-RVGEKIKDIQKALASLSQAQIQQLLTQEYLSLNLG 915 Query: 179 EEEIMCH 159 EEI+ H Sbjct: 916 SEEIVLH 922
>APE2_YEAST (P32454) Aminopeptidase 2 (EC 3.4.11.-) (Aminopeptidase II) (AP-II)| (YscII) Length = 844 Score = 32.0 bits (71), Expect = 0.38 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -2 Query: 356 EVSQFFATRVKPSFERALKQSLERVRISARW 264 E+ +FFAT+ F+++L QSL+ + A+W Sbjct: 813 EIKKFFATKSTKGFDQSLAQSLDTITSKAQW 843
>APE1_SCHPO (Q9USX1) Aminopeptidase 1 (EC 3.4.11.-) (Aminopeptidase I)| Length = 882 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = -2 Query: 356 EVSQFFATRVKPSFERALKQSLERVRISARWID 258 ++ +FFA + +ERAL+QSL+ + ++ +ID Sbjct: 834 KIKEFFADKDTKLYERALQQSLDTISANSSFID 866
>DFA1_SYNY3 (Q55393) Diflavin flavoprotein A 1 (EC 1.-.-.-) (SsATF573)| (NADH:oxygen oxidoreductase) Length = 573 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +3 Query: 240 GLALDAVDPSSADPHPLEALLQRSFERRLHASGKELG 350 G+ +D VD SSADP ++ L+ HASG LG Sbjct: 291 GVGVDMVDLSSADPQEIQELVG-------HASGVVLG 320 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,625,128 Number of Sequences: 219361 Number of extensions: 678487 Number of successful extensions: 1462 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)