ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl11g02 |
|---|---|
| Clone Library Name | barley_pub |
>RPB1_ARATH (P18616) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| Length = 1840 Score = 37.0 bits (84), Expect = 0.013 Identities = 18/27 (66%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Frame = -2 Query: 298 YSPTAPGYSPSSTG---PQATDKDDET 227 YSPT PGYSPSSTG P DK D+T Sbjct: 1801 YSPTLPGYSPSSTGQYTPHEGDKKDKT 1827 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 298 YSPTAPGYSPSSTGPQAT 245 YSPT+PGYSP+S G T Sbjct: 1559 YSPTSPGYSPTSPGYSPT 1576 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 298 YSPTAPGYSPSSTGPQAT 245 YSPT+PGYSP+S G T Sbjct: 1552 YSPTSPGYSPTSPGYSPT 1569 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 298 YSPTAPGYSPSSTGPQAT 245 YSP++PGYSP+S G T Sbjct: 1545 YSPSSPGYSPTSPGYSPT 1562 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 298 YSPTAPGYSPSSTGPQAT 245 YSPT+P YSPSS G T Sbjct: 1573 YSPTSPTYSPSSPGYSPT 1590 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 298 YSPTAPGYSPSS 263 YSPT+PGYSP+S Sbjct: 1699 YSPTSPGYSPTS 1710 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 298 YSPTAPGYSPSSTGPQAT 245 YSPT+P YSP+S G T Sbjct: 1692 YSPTSPAYSPTSPGYSPT 1709 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 Query: 298 YSPTAPGYSPSS 263 YSPT+PGYSP+S Sbjct: 1566 YSPTSPGYSPTS 1577
>CUT1_SCHPO (P18296) Separin (EC 3.4.22.49) (Separase) (Cell untimely torn| protein 1) Length = 1828 Score = 31.2 bits (69), Expect = 0.70 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -2 Query: 247 TDKDDETVD*KMAADRWLMQNHATLPTLVSLCV---QNRPCCKLRY 119 TDKD + KM L +N A S+C ++R CC LRY Sbjct: 1766 TDKDIDRFSLKMLESWGLFENKAPFVNSTSICTAVSESRSCCHLRY 1811
>RPB1_YEAST (P04050) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RNA polymerase II subunit 1) (B220) Length = 1733 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -2 Query: 298 YSPTAPGYSPSSTGPQATDKDDE 230 YSPT+PGYSP S P + K DE Sbjct: 1703 YSPTSPGYSPGS--PAYSPKQDE 1723
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 154 TRKQELVMWHGSASASGQQPFSNQQSRRPCQLPADRW 264 +RKQE+ W G + FS +Q P ++P W Sbjct: 161 SRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGW 197
>RPB1_MOUSE (P08775) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RPB1) Length = 1970 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 5/28 (17%) Frame = -2 Query: 298 YSPTAPGYSPSS-----TGPQATDKDDE 230 YSPT+PGYSP+S T P + D + Sbjct: 1940 YSPTSPGYSPTSPTYSLTSPAISPDDSD 1967
>RPB1_HUMAN (P24928) DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6)| (RPB1) Length = 1970 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 5/28 (17%) Frame = -2 Query: 298 YSPTAPGYSPSS-----TGPQATDKDDE 230 YSPT+PGYSP+S T P + D + Sbjct: 1940 YSPTSPGYSPTSPTYSLTSPAISPDDSD 1967
>RPB1_CRIGR (P11414) DNA-directed RNA polymerase II largest subunit (EC| 2.7.7.6) (RPB1) (Fragment) Length = 467 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 5/28 (17%) Frame = -2 Query: 298 YSPTAPGYSPSS-----TGPQATDKDDE 230 YSPT+PGYSP+S T P + D + Sbjct: 437 YSPTSPGYSPTSPTYSLTSPAISPDDSD 464
>LRC25_BOVIN (Q8MII8) Leucine-rich repeat-containing protein 25 precursor| (Monocyte and plasmacytoid-activated protein) Length = 307 Score = 28.1 bits (61), Expect = 5.9 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 184 GSASASGQQPFSNQQSRRPCQLPADRWTKGSSP 282 GS S SG+QP + Q RRP + PA+ + S+P Sbjct: 211 GSRSGSGRQPRYSSQGRRP-KSPANTPPRSSTP 242
>CRIM1_CHICK (Q8AWW5) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1048 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 209 C*PLADAEPCHITNSCFLVCPE 144 C PL AEP ++ SC +CPE Sbjct: 866 CPPLPCAEPINVEGSCCPMCPE 887
>TGBR3_RAT (P26342) TGF-beta receptor type III precursor (TGFR-3)| (Transforming growth factor beta receptor III) (Betaglycan) Length = 853 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 200 AVSSHFLINSLVVLVS-CLRTGGRRGVARC 286 AV+SH +I +VVL+S CL T G RC Sbjct: 2 AVTSHHMIPVMVVLMSACLATAGPEPSTRC 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,436,433 Number of Sequences: 219361 Number of extensions: 645754 Number of successful extensions: 1958 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1951 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
