| Clone Name | rbastl11f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRIA_CHLTR (O84783) Primosomal protein N' (EC 3.6.1.-) (ATP-depe... | 29 | 3.4 | 2 | TOP2_CANAL (P87078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoi... | 28 | 4.4 | 3 | SC24B_ARATH (Q9M081) Putative protein transport protein Sec24-li... | 27 | 9.9 | 4 | LGRD_BREPA (Q70LM4) Linear gramicidin synthetase subunit D [Incl... | 27 | 9.9 |
|---|
>PRIA_CHLTR (O84783) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 753 Score = 28.9 bits (63), Expect = 3.4 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 236 DHTERKNARLHTLIDYDLDNEVDACAL-PCPKEKQNALLFYSLL 108 D+T ++ R+HTLI +LD++ + PC K L Y L Sbjct: 671 DYTLKETQRVHTLIKQNLDSQASLMEISPCGHFKVKDLFHYQFL 714
>TOP2_CANAL (P87078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1461 Score = 28.5 bits (62), Expect = 4.4 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = -2 Query: 311 RRVMTSNKQQGGREEAAVEEN*VQRDHTERKNARLHTLIDYDLDNEVDACALPCPKEKQN 132 R T+ K Q ++ VE E+K+ ++ + NE A + PKEK + Sbjct: 1259 RAKATATKDQPNNKKVKVEPK-------EKKSTSAKPIVKKEASNEPQASSSSKPKEKDD 1311 Query: 131 ALLFYS 114 L F+S Sbjct: 1312 ILSFFS 1317
>SC24B_ARATH (Q9M081) Putative protein transport protein Sec24-like At4g32640| Length = 1069 Score = 27.3 bits (59), Expect = 9.9 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = -2 Query: 179 NEVDACALPCPKEKQ-----NALLFYSLLCTSVTSS 87 NE+ + ALP KE+ NAL Y C +VTSS Sbjct: 844 NEIPSKALPLVKEQATNSCINALYAYRKFCATVTSS 879
>LGRD_BREPA (Q70LM4) Linear gramicidin synthetase subunit D [Includes:| ATP-dependent tryptophan adenylase (TrpA) (Tryptophan activase); ATP-dependent D-leucine adenylase (D-LeuA) (D-Leucine activase); Leucine racemase [ATP-hydrolyzing] (EC 5.1.1.-); ATP-d Length = 5085 Score = 27.3 bits (59), Expect = 9.9 Identities = 18/56 (32%), Positives = 26/56 (46%) Frame = +1 Query: 145 FGHGRAHASTSLSRS*SINVCSRAFFRSVWSLWT*FSSTAASSLPPCCLLLVMTRL 312 F H RA+ T+ R+ + AF SVW +W + A LP + LV +L Sbjct: 1690 FWHQRAYDVTATDRA--SQIAGTAFDASVWEIWPYVTKGATLYLPEEEIRLVPEKL 1743 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,854,269 Number of Sequences: 219361 Number of extensions: 795509 Number of successful extensions: 1739 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1739 length of database: 80,573,946 effective HSP length: 81 effective length of database: 62,805,705 effective search space used: 1507336920 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)