Clone Name | rbastl11f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cel... | 31 | 1.3 | 2 | MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 trans... | 30 | 3.7 | 3 | CCSA_CYACA (O19901) Cytochrome c biogenesis protein ccsA | 28 | 8.2 |
---|
>LY6E_CHICK (Q90986) Lymphocyte antigen Ly-6E precursor (Stem cell antigen 2)| (SCA-2) Length = 126 Score = 31.2 bits (69), Expect = 1.3 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -3 Query: 352 EKTGNHLCFKCSSATSNFGANCCTISKCTILPSIVANHCTNEHHCLT 212 E+ +CF CS A+SN+ C T KC NE HC+T Sbjct: 16 ERAHTLICFSCSDASSNWA--CLTPVKC----------AENEEHCVT 50
>MTAL2_PICAN (Q707Y8) Mating-type protein ALPHA2 (MATalpha2 transcription| factor) Length = 163 Score = 29.6 bits (65), Expect = 3.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 68 DKTVAIQKELCFHISQDTRLPPNDI 142 ++T+ I KEL ++QDTR PND+ Sbjct: 138 ERTLTISKELSDLLNQDTRCSPNDV 162
>CCSA_CYACA (O19901) Cytochrome c biogenesis protein ccsA| Length = 293 Score = 28.5 bits (62), Expect = 8.2 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 12/106 (11%) Frame = -2 Query: 335 SLLQVLISHKQLRSKLLYNKQVYYFAF--HC---GQSLYK*APLSNCTRTHHQKLVNLLQ 171 + L L+S +KL Y KQ+ F+ C + L C R + L NL + Sbjct: 16 AFLGALVSSLFYWAKLTYYKQIQVFSLPKFCLIFSNCIIAGMLLERCFRYSYFPLSNLYE 75 Query: 170 NLPSVSWAVKC-------HLAVVSCLAICENTILFGWQLFCLPSLL 54 +L +SW + L+++ + T++ G+ + LP L Sbjct: 76 SLLFLSWVLNIITIIFVDKLSIIGAIGSSAVTLIIGYANYILPPSL 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,336,289 Number of Sequences: 219361 Number of extensions: 1229147 Number of successful extensions: 2531 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2531 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)