Clone Name | rbastl11d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RCC1_XENLA (P25183) Regulator of chromosome condensation | 30 | 1.7 | 2 | LAC9_KLULA (P08657) Lactose regulatory protein LAC9 | 28 | 8.2 |
---|
>RCC1_XENLA (P25183) Regulator of chromosome condensation| Length = 424 Score = 30.0 bits (66), Expect = 1.7 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 6/60 (10%) Frame = +2 Query: 59 CVHNQVKPYGRIHWQ-ALCATIITLHVWNSNTQLQ*LAIENFHLL-----QGCYGYCNMT 220 C+H + K GR+H+Q C T V + + + N+H L Q CY N+T Sbjct: 234 CIHLKAKGSGRVHFQDVFCGAYFTFAV-SQEGHVYGFGLSNYHQLGTKNTQACYAPQNLT 292
>LAC9_KLULA (P08657) Lactose regulatory protein LAC9| Length = 865 Score = 27.7 bits (60), Expect = 8.2 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 2 AFSQHQQPLLALNSSKKIYCVHN-QVKPYGRIHWQALCATIITLHVWNSNT 151 A+ +H L L S + + +N Q+KP W L ++ L W SN+ Sbjct: 391 AYFKHYHALYPLVSKEMFFAQYNDQIKPENVEIWHILLNAVLALGSWCSNS 441 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,025,032 Number of Sequences: 219361 Number of extensions: 616804 Number of successful extensions: 1049 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1049 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)