Clone Name | rbastl11d05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MT2_CANGA (P15114) Metallothionein-2 (MT-2) (Metallothionein-II)... | 30 | 2.3 | 2 | GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC... | 29 | 3.9 | 3 | FIXC_RHISN (Q53208) Protein fixC | 28 | 8.6 |
---|
>MT2_CANGA (P15114) Metallothionein-2 (MT-2) (Metallothionein-II) (MT-II)| [Contains: Metallothionein-2' (MT-2') (Metallothionein-II') (MT-II')] Length = 51 Score = 29.6 bits (65), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 116 SCCGVPLYICCNSITEWCCTRAVRCLTC 33 +CC P C NS + C + +C TC Sbjct: 22 NCCAKPACACTNSASNECSCQTCKCQTC 49
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -3 Query: 119 YSCCGVPLYICCNSITEWCCTRAVRCLTCFY 27 + CC +P +CC S + CC + CL Y Sbjct: 384 WGCCPIPEAVCC-SDNQHCCPQGFTCLAQGY 413
>FIXC_RHISN (Q53208) Protein fixC| Length = 435 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 Query: 136 QNFINSSATPKIEKPILT*AALV 204 QNF+ TPKIEK T AAL+ Sbjct: 393 QNFVRVDGTPKIEKERATTAALI 415 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,526,326 Number of Sequences: 219361 Number of extensions: 337820 Number of successful extensions: 992 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 80,573,946 effective HSP length: 43 effective length of database: 71,141,423 effective search space used: 1707394152 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)