Clone Name | rbastl11b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZN451_HUMAN (Q9Y4E5) Zinc finger protein 451 (Coactivator for st... | 35 | 0.040 | 2 | NSD1_HUMAN (Q96L73) Histone-lysine N-methyltransferase, H3 lysin... | 31 | 0.99 | 3 | NSD1_MOUSE (O88491) Histone-lysine N-methyltransferase, H3 lysin... | 29 | 3.7 |
---|
>ZN451_HUMAN (Q9Y4E5) Zinc finger protein 451 (Coactivator for steroid| receptors) Length = 1061 Score = 35.4 bits (80), Expect = 0.040 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 47 GSCRKTLLDSDGFTANYNHYHCTLMKPSENSRGWKRNNYYKRNAEAA 187 G+C K D + +++ HC L KPS G +++N YK A A+ Sbjct: 792 GTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASAS 838
>NSD1_HUMAN (Q96L73) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) (Androgen r Length = 2696 Score = 30.8 bits (68), Expect = 0.99 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 194 TEMPPQHFSCNSCSFSIHGCFHLVSSVCSDS 102 TEMP F CN C IH CF VC S Sbjct: 1574 TEMPRGKFICNECRTGIHTCF-----VCKQS 1599
>NSD1_MOUSE (O88491) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) Length = 2588 Score = 28.9 bits (63), Expect = 3.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 191 EMPPQHFSCNSCSFSIHGCFHLVSSVCSDS 102 EMP F CN C IH CF VC S Sbjct: 1473 EMPRGKFICNECHTGIHTCF-----VCKQS 1497 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,005,227 Number of Sequences: 219361 Number of extensions: 414431 Number of successful extensions: 1123 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1112 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1123 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)