Clone Name | rbastl11b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | UVRC_LACLA (Q9CH98) UvrABC system protein C (Protein uvrC) (Exci... | 28 | 6.4 | 2 | CC2H1_TRYCO (P54664) Cell division control protein 2 homolog 1 (... | 28 | 8.3 |
---|
>UVRC_LACLA (Q9CH98) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 668 Score = 28.1 bits (61), Expect = 6.4 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = -2 Query: 194 VFSMREITGYYSGNTFEFWLRYCLHVVLNHVF*RTVPRGTQGIFEYTTYMLKSVTNRME 18 +F R+ + F F + CL V+NHV + TQ + E+ T K + N +E Sbjct: 145 IFPFRKCGLHEKKVCFYFHIHQCLCPVVNHVDPQVFKDMTQEVKEFLTGSDKKIVNELE 203
>CC2H1_TRYCO (P54664) Cell division control protein 2 homolog 1 (EC 2.7.11.22)| Length = 301 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +3 Query: 72 LSTPRHR--PSKNMIQHNVKTITKPEFK--CIATIVACYFTHAKYSRI 203 L TP + PS N+ ++ ++KPEF+ IAT + TH Y+++ Sbjct: 219 LGTPSSQVWPSMNLYPNSTNMLSKPEFQQNLIATCDEQFQTHPAYAKL 266 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,428,872 Number of Sequences: 219361 Number of extensions: 574051 Number of successful extensions: 1461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1461 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)