Clone Name | rbastl11b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LPSD_RHIME (Q9R9N0) Lipopolysaccharide core biosynthesis glycosy... | 29 | 2.8 | 2 | Y355_BIFLO (Q8G7B5) UPF0286 protein BL0355 | 28 | 4.9 | 3 | E1BL_ADEM1 (P12536) E1B protein, large T-antigen (55 kDa protein) | 28 | 4.9 | 4 | TXAC_DENPO (P25681) Acetylcholinesterase toxin C | 28 | 6.3 |
---|
>LPSD_RHIME (Q9R9N0) Lipopolysaccharide core biosynthesis glycosyl transferase| lpsD (EC 2.-.-.-) Length = 343 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 181 ETGRALYEAVFQRLSLCRAL*GVRVWRVV-PFEP 83 E G +YE VF+R+SL R L R+ RV+ FEP Sbjct: 47 ENGATIYEGVFRRISLSRFLLKWRMNRVLREFEP 80
>Y355_BIFLO (Q8G7B5) UPF0286 protein BL0355| Length = 256 Score = 28.5 bits (62), Expect = 4.9 Identities = 21/43 (48%), Positives = 24/43 (55%), Gaps = 9/43 (20%) Frame = -1 Query: 201 SLAIFRE----KP----EEPCTRRSSNASA-SAEHSRECVCGG 100 SL IF E KP PCT R + +A SA+HSRE V GG Sbjct: 34 SLLIFSELGSYKPLNWMTAPCTIREIDPAAKSAQHSRESVAGG 76
>E1BL_ADEM1 (P12536) E1B protein, large T-antigen (55 kDa protein)| Length = 433 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/29 (55%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -1 Query: 135 SAEHSREC--VCGGLYLLSLCCVVHRTCT 55 S EHSREC CGG + L VVH T T Sbjct: 386 SREHSRECQCFCGGRHRLLFPSVVHITPT 414
>TXAC_DENPO (P25681) Acetylcholinesterase toxin C| Length = 61 Score = 28.1 bits (61), Expect = 6.3 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = -1 Query: 222 CLSSTP*SLAIFREKPEEPCTRRSSNASASAEHSRECVC--GGLYLLSLCCVVHRTC 58 C S T S AI ++ E C R+S R C C G YL CC C Sbjct: 3 CYSHTTTSRAILKDCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKC 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,677,116 Number of Sequences: 219361 Number of extensions: 550247 Number of successful extensions: 1290 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1275 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1289 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)