Clone Name | rbastl11a07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BTKL_DROME (P08630) Tyrosine-protein kinase Btk29A (EC 2.7.10.2)... | 29 | 2.5 | 2 | HEPH_MOUSE (Q9Z0Z4) Hephaestin precursor (EC 1.-.-.-) | 28 | 7.4 | 3 | OR4D2_HUMAN (P58180) Olfactory receptor 4D2 (Olfactory receptor ... | 27 | 9.7 |
---|
>BTKL_DROME (P08630) Tyrosine-protein kinase Btk29A (EC 2.7.10.2) (Dsrc28C)| Length = 786 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 225 VLEMPKN*QSEVHDISCLPWQYCPSHQPKIR 317 +LE PK+ E++D+ L W + P +P R Sbjct: 741 ILEKPKSCAKEIYDVMKLCWSHGPEERPAFR 771
>HEPH_MOUSE (Q9Z0Z4) Hephaestin precursor (EC 1.-.-.-)| Length = 1157 Score = 27.7 bits (60), Expect = 7.4 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 276 LPWQYCPSHQPKIRWHNRTK 335 + W YCP ++ WHN ++ Sbjct: 741 IEWDYCPDRSWELEWHNTSE 760
>OR4D2_HUMAN (P58180) Olfactory receptor 4D2 (Olfactory receptor OR17-24)| (B-lymphocyte membrane protein BC2009) Length = 307 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 268 MSWTSDC*FLGISNTRSLSR 209 ++W SD FLG+S TR L R Sbjct: 6 LTWVSDFVFLGLSQTRELQR 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,557,851 Number of Sequences: 219361 Number of extensions: 918442 Number of successful extensions: 1992 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1991 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)