Clone Name | rbastl11a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DHH1_CANGA (Q6FQU5) ATP-dependent RNA helicase DHH1 (EC 3.6.1.-) | 29 | 3.6 | 2 | SGS3_DROYA (P13728) Salivary glue protein Sgs-3 precursor | 28 | 4.7 |
---|
>DHH1_CANGA (Q6FQU5) ATP-dependent RNA helicase DHH1 (EC 3.6.1.-)| Length = 507 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 90 RKQTHNATQTQPQPGHRVRRPGDTTFVLPQVSFSLFLPIP 209 ++Q Q Q Q G + PG F+ PQ F+P+P Sbjct: 429 QEQQQQQQQQQGQQGQQQGYPGQQAFIPPQQGQPQFMPVP 468
>SGS3_DROYA (P13728) Salivary glue protein Sgs-3 precursor| Length = 263 Score = 28.5 bits (62), Expect = 4.7 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 33 PTFRSTHPTHSTYSNTTEYRKQTHNATQTQP-QPGHRVRRPGDTT 164 PT RST H+T + TT R T T +P RRP TT Sbjct: 109 PTTRSTTTRHTTTTTTTTRRPTTTTTTTRRPTTTTTTTRRPTTTT 153 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +3 Query: 33 PTFRSTHPTHSTYSNTTEYRKQTHNATQTQPQP 131 PT RST H+T S T+ ++ TH T T +P Sbjct: 159 PTTRSTTTRHTTKSTTS--KRPTHETTTTSKRP 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,714,883 Number of Sequences: 219361 Number of extensions: 565973 Number of successful extensions: 1598 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1597 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)