Clone Name | rbastl10h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1492_METJA (Q58887) Hypothetical protein MJ1492 | 28 | 5.0 | 2 | UL52_HHV7J (P52468) Helicase/primase complex protein | 28 | 8.6 |
---|
>Y1492_METJA (Q58887) Hypothetical protein MJ1492| Length = 156 Score = 28.5 bits (62), Expect = 5.0 Identities = 12/22 (54%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 92 LCTY-LFSLICHQSPKCTAFIF 30 +C Y ++SLICHQ P+ + FIF Sbjct: 40 ICLYAVYSLICHQMPQRSFFIF 61
>UL52_HHV7J (P52468) Helicase/primase complex protein| Length = 861 Score = 27.7 bits (60), Expect = 8.6 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +3 Query: 87 TEFSFIDAPKHRLYMTAKAIFQLLMSKYLGSAGKS 191 TEFSFID+ +LY ++ + L KYL G S Sbjct: 704 TEFSFIDSRTKQLYHRKQSSLETLCLKYLHVNGFS 738 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,576,054 Number of Sequences: 219361 Number of extensions: 442179 Number of successful extensions: 1226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1213 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)