Clone Name | rbastl10c02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y1901_STRPN (Q97NV8) Hypothetical RNA methyltransferase SP1901 (... | 28 | 4.9 | 2 | Y1717_STRR6 (Q8DNH6) Hypothetical RNA methyltransferase spr1717 ... | 28 | 4.9 |
---|
>Y1901_STRPN (Q97NV8) Hypothetical RNA methyltransferase SP1901 (EC 2.1.1.-)| Length = 451 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 56 YTKLSGCHV*QCTADKQRQFTTKILHQHR*SYTLIKVENKE 178 Y + GC + DKQ +F T +LHQ + EN E Sbjct: 76 YNECGGCQIMHLHYDKQLEFKTDLLHQALKKFAPAGYENYE 116
>Y1717_STRR6 (Q8DNH6) Hypothetical RNA methyltransferase spr1717 (EC 2.1.1.-)| Length = 451 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +2 Query: 56 YTKLSGCHV*QCTADKQRQFTTKILHQHR*SYTLIKVENKE 178 Y + GC + DKQ +F T +LHQ + EN E Sbjct: 76 YNECGGCQIMHLHYDKQLEFKTDLLHQALKKFAPAGYENYE 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,508,988 Number of Sequences: 219361 Number of extensions: 454869 Number of successful extensions: 732 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 729 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)