Clone Name | rbastl09h09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MOB1_YEAST (P40484) Maintenance of ploidy protein MOB1 (MPS1 bin... | 28 | 9.1 |
---|
>MOB1_YEAST (P40484) Maintenance of ploidy protein MOB1 (MPS1 binder 1)| Length = 236 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 4 LILHTPDFYFRLNMLPTRYEEEMKKCTCPRL 96 L +H DFY ++NML E TCPR+ Sbjct: 79 LAVHCVDFYNQINMLYGSITEFCSPQTCPRM 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,328,463 Number of Sequences: 219361 Number of extensions: 271577 Number of successful extensions: 500 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 500 length of database: 80,573,946 effective HSP length: 25 effective length of database: 75,089,921 effective search space used: 1802158104 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)