| Clone Name | rbastl09h05 |
|---|---|
| Clone Library Name | barley_pub |
>RL1D1_PONPY (Q5RCE6) Ribosomal L1 domain-containing protein 1| Length = 490 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 216 NIQKIKERDEKRKIARKSVLRLKMDLQLVSSGDAMI 109 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>RL1D1_HUMAN (O76021) Ribosomal L1 domain-containing protein 1 (Cellular| senescence-inhibited gene protein) (PBK1 protein) (CATX-11) Length = 490 Score = 28.1 bits (61), Expect = 5.7 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 216 NIQKIKERDEKRKIARKSVLRLKMDLQLVSSGDAMI 109 N +K KER +KR+ ARK+ L D SGD + Sbjct: 295 NFEKQKERKKKRQQARKTASVLSKDDVAPESGDTTV 330
>ERG6_PNECA (Q96WX4) Sterol 24-C-methyltransferase (EC 2.1.1.41)| (Delta(24)-sterol C-methyltransferase) Length = 377 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/43 (39%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 285 CHVGGPLCQ---FHTTGTVG**RCFYNIQKIKERDEKRKIARK 166 C VGGP CQ F VG Y IQ+ K EK+ ++ K Sbjct: 135 CGVGGPACQISVFTGANIVGLNNNDYQIQRAKYYSEKKGLSDK 177
>VND_DROME (P22808) Homeobox protein vnd (Protein ventral nervous system| defective) (Homeobox protein NK-2) Length = 723 Score = 27.7 bits (60), Expect = 7.4 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 28 TPTQTSHLFLHHRFLSKKASSWKGVGRDHCISRGH 132 TPTQ F +HR+ +K+A + KG + GH Sbjct: 585 TPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGH 619
>FDHE_AQUAE (O67150) Protein fdhE homolog| Length = 283 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 95 FHDEAFFDKKRWCKNRCEVC 36 F D+ F+ +RW KN C VC Sbjct: 151 FADKVKFEHERWFKNYCPVC 170
>HISX_BLOFL (Q7VQX0) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 437 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 121 RCNDLSQLPSMMRPFLTKNGGVRIDVKFVL 32 RC+ QL + RP N + +DVK++L Sbjct: 14 RCSISEQLTLLTRPINKHNNSIHLDVKYIL 43
>CHMU_ARATH (P42738) Chorismate mutase, chloroplast precursor (EC 5.4.99.5)| (CM-1) Length = 334 Score = 27.7 bits (60), Expect = 7.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 323 GRQLSCDAICCNCVM*EVHFASFI 252 G CDAIC C+ +H+ F+ Sbjct: 207 GSTAVCDAICLQCLSKRIHYGKFV 230
>HSDR_STAAN (Q7A801) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 83 AFFDKKRWCKNRCEV 39 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109
>HSDR_STAAM (Q99X26) Type-1 restriction enzyme R protein (EC 3.1.21.3) (Type I| restriction enzyme R protein) Length = 929 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 83 AFFDKKRWCKNRCEV 39 +F DKK WCKN+ +V Sbjct: 95 SFLDKKSWCKNKFQV 109 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,402,697 Number of Sequences: 219361 Number of extensions: 711627 Number of successful extensions: 1903 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1877 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1903 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)