Clone Name | rbastl09h04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EFGL_THEMA (Q9X1Y4) Elongation factor G-like protein | 30 | 1.9 | 2 | UACA_CANFA (Q9GL21) Uveal autoantigen with coiled-coil domains a... | 29 | 2.5 | 3 | Y1161_HELHP (Q7VH06) Hypothetical UPF0324 membrane protein HH_1161 | 28 | 7.2 | 4 | GP160_MOUSE (Q3U3F9) Probable G-protein coupled receptor 160 | 28 | 7.2 | 5 | UACA_BOVIN (Q8HYY4) Uveal autoantigen with coiled-coil domains a... | 28 | 7.2 |
---|
>EFGL_THEMA (Q9X1Y4) Elongation factor G-like protein| Length = 683 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +1 Query: 97 VHCDISHK*SKKIKFLNINISNFLLTYRLTVAPVKQREHQHTKET 231 +H D+ + KKI +++ + + YR T+ EH+H K+T Sbjct: 439 MHLDVMIERLKKIFGVDVEVGKPKIAYRETITTTAVAEHKHKKQT 483
>UACA_CANFA (Q9GL21) Uveal autoantigen with coiled-coil domains and ankyrin| repeats protein Length = 1415 Score = 29.3 bits (64), Expect = 2.5 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 196 VKQREHQHTKETKHTRAGQLNKRL*HLIDKNALTVGLSRDLQ 321 VK EH+ K RAG+L K++ L KN + L RD++ Sbjct: 681 VKPEEHEQLKSRLEQRAGELAKKVTELTSKNQV---LQRDVE 719
>Y1161_HELHP (Q7VH06) Hypothetical UPF0324 membrane protein HH_1161| Length = 345 Score = 27.7 bits (60), Expect = 7.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -3 Query: 270 SKPFVELAGPCVFGFLGMLVFSLLYWCNCKPVSE 169 SK V L +FG +GM++ +Y+ N P+++ Sbjct: 150 SKSSVALGFIVIFGLIGMILLPAIYYANILPLND 183
>GP160_MOUSE (Q3U3F9) Probable G-protein coupled receptor 160| Length = 336 Score = 27.7 bits (60), Expect = 7.2 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -3 Query: 234 FGFLGMLVFSLL---YWCNCKPVSEQKVRDVYV*KLYFLRSLVTNIAM 100 +GFL V SL YWCN S+Q R + LYFL ++T I++ Sbjct: 105 YGFLHYPVCSLACIDYWCNLSRASKQSSR--WQKLLYFLTVILTWISV 150
>UACA_BOVIN (Q8HYY4) Uveal autoantigen with coiled-coil domains and ankyrin| repeats protein (Beta-actin-binding protein) (BetaCAP73) Length = 1401 Score = 27.7 bits (60), Expect = 7.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 196 VKQREHQHTKETKHTRAGQLNKRL*HLIDKN 288 VK EH+ K ++G+L KR+ L KN Sbjct: 667 VKPEEHEQLKSRLEQKSGELGKRITELTSKN 697 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,359,097 Number of Sequences: 219361 Number of extensions: 928284 Number of successful extensions: 2445 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)