| Clone Name | rbastl09h01 |
|---|---|
| Clone Library Name | barley_pub |
>L_PI2HT (P26676) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2262 Score = 29.3 bits (64), Expect = 2.6 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = +2 Query: 110 REALNTTLRLGVQLS*AASVFP--RCSYWLQSAPMSF--KAVISLGKILPNASLKPMEQE 277 RE N RLGV S P R + W A + + L K LP++ L+P+EQ Sbjct: 54 REESNLAERLGVAKSELIKRVPAFRATRWRSHAAVLIWPSCIPFLVKFLPHSKLQPVEQW 113 Query: 278 YSLL 289 Y L+ Sbjct: 114 YKLI 117
>RGF1_SCHPO (Q9Y7U6) Rho1 guanine nucleotide exchange factor 1| Length = 1334 Score = 28.5 bits (62), Expect = 4.4 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 197 SAPMSFKAVISLGKILPNASLKPMEQEYSLLLSVGQASSFSLP 325 ++P+ FK V +L +PN S + +EYSLLL + +S P Sbjct: 1026 NSPLQFKPVRALN--IPNISQLEVIEEYSLLLLLSDKVLYSYP 1066
>RPM1_CAEEL (Q17551) Ubiquitin ligase protein rpm-1 (EC 6.3.2.-)| (Pam/highwire/rpm-1 protein) (Regulator of presynaptic morphology protein 1) (Synapse defective protein 3) Length = 3766 Score = 28.1 bits (61), Expect = 5.7 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -3 Query: 318 LNDDACPTDSNKEYSCSMGFKLALGKILPRLITALKDIGADCSQYEHLGKT 166 L +DACP+ S+K SC + +A C + EHLG T Sbjct: 201 LREDACPSVSSKATSCLVALSVA------------------CGEPEHLGST 233
>ZYG1_CAEEL (Q9GT24) Probable serine/threonine-protein kinase zyg-1 (EC| 2.7.11.1) (Zygote defective protein 1) Length = 706 Score = 28.1 bits (61), Expect = 5.7 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 226 DHSLEGHRSRL-QPVRAPREDRSR 158 +HS +G R R +PVR+ R+DRSR Sbjct: 263 EHSRDGRRQRSREPVRSSRDDRSR 286
>SHCBP_HUMAN (Q8NEM2) SHC SH2 domain-binding protein 1| Length = 672 Score = 27.7 bits (60), Expect = 7.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 54 IQHLLFYYLNIWETW 10 I+H+ F+Y NIW +W Sbjct: 195 IEHVRFFYQNIWRSW 209
>BCTN7_SHEEP (P50415) Bactenecin-7 precursor (Bac7) (Cathelicidin-3) (PR-59)| Length = 190 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 176 RCSYWLQSAPMSFKAVISLGKILPNASLKPMEQEYSLLLSVGQASSFS 319 RCS WL + LG +LP+AS + + ++L +VGQ + S Sbjct: 12 RCSLWL----------LLLGLLLPSASAQALSYREAVLRAVGQLNEKS 49
>YEW4_YEAST (P40081) Hypothetical 20.4 kDa protein in GLC7-GDI1 intergenic| region Length = 178 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -3 Query: 273 CSMGFKLALGKILPRLITALKDIGADCSQYEHLGKTEAAQE 151 C G++L + K +PR++ LKD G E AQE Sbjct: 44 CRDGYELTIYKDIPRILGDLKDNGVKLMTASRTWAPEIAQE 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,487,722 Number of Sequences: 219361 Number of extensions: 896101 Number of successful extensions: 2510 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2508 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)