Clone Name | rbastl09g06 |
---|---|
Clone Library Name | barley_pub |
>TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-associated| protein 1) (Telomerase protein 1) (p240) (p80 telomerase homolog) Length = 2627 Score = 33.5 bits (75), Expect = 0.15 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 11/93 (11%) Frame = +2 Query: 26 CHLVVSNPSIQILMHVRIMQNHALATKQQLLAPQHRVW-----------QELDSAGYLTK 172 CHL Q+ M +RI + +++L + R W Q L++A L+ Sbjct: 612 CHLSRQ----QLRMAMRIPVLYEQLKREKLRVHKARQWKYDGEMLNRYRQALETAVNLSV 667 Query: 173 KCSLPIIPSRTPTLLPLDLLFEAMCPPSRHPEG 271 K SLP++P RT + D + +CP S +P+G Sbjct: 668 KHSLPLLPGRTVLVYLTDANADRLCPKS-NPQG 699
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 156 AESSSCQTRCCGANSCCFVARAWFCMILTCISIC 55 A +SSCQ CC SC + C C S+C Sbjct: 325 ASASSCQPSCCRTASCVSLLCRPMCSRPACYSLC 358 Score = 28.9 bits (63), Expect = 3.6 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = -3 Query: 153 ESSSCQTRCCGANSC---CFV---ARAWFCMILTCISIC 55 + SSCQ CC ++ C C V + C + C+S+C Sbjct: 91 QQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVC 129
>KR10A_HUMAN (P60014) Keratin-associated protein 10-10 (Keratin-associated| protein 10.10) (High sulfur keratin-associated protein 10.10) (Keratin-associated protein 18-10) (Keratin-associated protein 18.10) Length = 251 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 156 AESSSCQTRCCGANSCCFVARAWFCMILTCISIC 55 A +SSCQ CC SC + C C S+C Sbjct: 211 ASASSCQPSCCRTASCVSLLCRPVCSRPACYSLC 244
>SULH_SCHPO (O74377) Probable sulfate permease C3H7.02| Length = 877 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +1 Query: 25 LSPCGVKSVYTNTYACQDHAKPCPSYKTAAIGATAPRLAGARLCWL 162 + P V S+ T+ AK P+Y A IG T LAGA C L Sbjct: 188 IGPVAVMSLVTSKVIANVQAKD-PNYDAAQIGTTLALLAGAITCGL 232
>ODD_DROME (P23803) Protein odd-skipped| Length = 392 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 29 HLVVSNPSIQILMHVRIMQNHALATKQQLLAPQHRVWQEL 148 H +S ++ +H+R M ++ +QQ QHR+W ++ Sbjct: 61 HPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHRLWLQM 100
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 6/39 (15%) Frame = -3 Query: 153 ESSSCQTRCCGANS----CC--FVARAWFCMILTCISIC 55 + SSCQ CC ++S CC + +C + C+ +C Sbjct: 170 QQSSCQPACCTSSSYQQACCVPVCCKTVYCKPICCVPVC 208 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -3 Query: 147 SSCQTRCCGANSC---CFVARAWFCMILTCISIC 55 SSCQ CC ++SC C V C + C+S C Sbjct: 130 SSCQPACCASSSCQPACCVPVC--CKPVCCVSTC 161 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 156 AESSSCQTRCCGANSCCFVARAWFCMILTCISIC 55 A +SSCQ+ CC SC + L C S+C Sbjct: 258 APTSSCQSSCCCPASCVSLLCRPASSRLACYSLC 291
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Frame = -3 Query: 153 ESSSCQTRCCGANSC---CFV---ARAWFCMILTCISIC 55 + SSCQ CC ++ C C V ++ C + C+SIC Sbjct: 100 QQSSCQPACCTSSPCQQACCVPVCCKSNCCKPVCCVSIC 138
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -3 Query: 153 ESSSCQTRCCGANSCCFVARA-WFCMILTCISIC 55 + SSCQ CC ++SC R C + C+ C Sbjct: 122 QQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTC 155
>YNK0_YEAST (P50945) Hypothetical 27.0 kDa protein in POL1-RAS2 intergenic| region Length = 234 Score = 27.7 bits (60), Expect = 8.0 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +2 Query: 83 QNHALATKQQLLAPQ-----HRVWQELDSAGYLTKKCSL 184 QN AT+ LL H W+ + GY+ KKC L Sbjct: 170 QNLVNATENDLLPADFVKSYHNTWKRIYEEGYVAKKCDL 208
>C43BP_MOUSE (Q9EQG9) Goodpasture antigen-binding protein (EC 2.7.11.9) (GPBP)| (Collagen type IV alpha-3-binding protein) (StAR-related lipid transfer protein 11) (StARD11) (START domain-containing protein 11) Length = 624 Score = 27.7 bits (60), Expect = 8.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 247 AHCLKQQVKRKKSWRSRGD 191 +HC++ VKR++SW+ R D Sbjct: 260 SHCIELMVKREESWQKRHD 278
>GHR_PIG (P19756) Growth hormone receptor precursor (GH receptor)| (Somatotropin receptor) [Contains: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)] Length = 638 Score = 27.7 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +1 Query: 1 GLKECSRKL---SPCGVKSVYTNTYACQDHAKPC 93 G+ +C L SPC + N Y C+ AK C Sbjct: 510 GISQCDMHLEVVSPCPANFIMDNAYFCEADAKKC 543
>CUL2_PONPY (Q5RCF3) Cullin-2 (CUL-2)| Length = 745 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 68 HVRIMQNHALATKQQLLAPQHRVWQE 145 HVR + L +++Q+L HR W+E Sbjct: 68 HVRHLHKRVLESEEQVLVMYHRYWEE 93
>CUL2_HUMAN (Q13617) Cullin-2 (CUL-2)| Length = 745 Score = 27.7 bits (60), Expect = 8.0 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 68 HVRIMQNHALATKQQLLAPQHRVWQE 145 HVR + L +++Q+L HR W+E Sbjct: 68 HVRHLHKRVLESEEQVLVMYHRYWEE 93
>VEGFD_HUMAN (O43915) Vascular endothelial growth factor D precursor (VEGF-D)| (c-fos-induced growth factor) (FIGF) Length = 354 Score = 27.7 bits (60), Expect = 8.0 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 6/61 (9%) Frame = +1 Query: 10 ECSRKLSPCGVKS--VYTNTYACQD----HAKPCPSYKTAAIGATAPRLAGARLCWLPNK 171 EC L C K + +T +C+D H +PC S KTA A+ C P + Sbjct: 292 ECKESLETCCQKHKLFHPDTCSCEDRCPFHTRPCASGKTAC----------AKHCRFPKE 341 Query: 172 K 174 K Sbjct: 342 K 342 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,226,846 Number of Sequences: 219361 Number of extensions: 722277 Number of successful extensions: 2331 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 2058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2308 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)