| Clone Name | rbastl09d06 |
|---|---|
| Clone Library Name | barley_pub |
>V119_ASFL5 (P26703) LIS 119-1 protein precursor| Length = 119 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 174 NYVHTLSVQRKYVNCSFFLEPPSPYKSFHCFNSPIM 281 +Y+ S+ R + C +F++P SPY + + PI+ Sbjct: 78 DYISQCSIARYFDRCMYFIKPKSPYIHYMDCSQPIV 113
>SYI_COLP3 (Q486U0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 953 Score = 30.0 bits (66), Expect = 1.4 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 6/53 (11%) Frame = -1 Query: 340 MADLKEAKNQVAASFAAEGSIMGE----LKQW--NDLYGEGGSRKKEQLTYFL 200 M+D K+ N A SFA +G++ LK W DLYG+ KK + ++ L Sbjct: 1 MSDYKQTLNLPATSFAMKGNMANREPNMLKYWAAKDLYGKIREAKKGKKSFIL 53
>HFE_PANTR (P60018) Hereditary hemochromatosis protein homolog precursor| (HLA-H) Length = 348 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 194 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 328 C ++ QLL L R Q+ PL+++TH+ T S T R L ++ Sbjct: 187 CPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYY 231
>HFE_HUMAN (Q30201) Hereditary hemochromatosis protein precursor (HLA-H)| Length = 348 Score = 29.6 bits (65), Expect = 1.8 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +2 Query: 194 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 328 C ++ QLL L R Q+ PL+++TH+ T S T R L ++ Sbjct: 187 CPAQLQQLLELGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYY 231
>MYOM_LYMST (Q25413) Myomodulin neuropeptides precursor [Contains:| GLQMLRL-amide; QIPMLRL-amide; SMSMLRL-amide; SLSMLRL-amide; Myomodulin A (PMSMLRL-amide)] Length = 350 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 386 EDERKRQGDHSEAIKHGRFERSKEPGG 306 E+ER+ GD E +H RF RS E G Sbjct: 97 EEERELSGDELEVPEHHRFRRSTENSG 123
>RL3_HELHP (Q7VGE4) 50S ribosomal protein L3| Length = 192 Score = 28.5 bits (62), Expect = 4.1 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Frame = -1 Query: 382 MKEKDKEIILRPLNMADLKEAKNQVAASFAAEG-SIMGELKQWNDLYGEG--GSRKKEQL 212 +K +KE+ L++A L EAK +V SF +G G +K+WN G G GSR +L Sbjct: 73 LKVSNKEV--GELDVASLSEAK-RVQVSFKTKGRGFSGAMKRWNFQGGPGAHGSRFHRRL 129
>LUXS_STAES (Q8CNI0) S-ribosylhomocysteine lyase (EC 4.4.1.21) (Autoinducer-2| production protein luxS) (AI-2 synthesis protein) Length = 156 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 10/39 (25%) Frame = -1 Query: 322 AKNQVAASFAAEGSIMG----------ELKQWNDLYGEG 236 A N+V +AA S+ G + +QWND+YGEG Sbjct: 117 ACNEVQCGWAASHSLEGAKTIAQAFLDKREQWNDIYGEG 155
>LUXS_STAEQ (Q5HM88) S-ribosylhomocysteine lyase (EC 4.4.1.21) (Autoinducer-2| production protein luxS) (AI-2 synthesis protein) Length = 156 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 10/39 (25%) Frame = -1 Query: 322 AKNQVAASFAAEGSIMG----------ELKQWNDLYGEG 236 A N+V +AA S+ G + +QWND+YGEG Sbjct: 117 ACNEVQCGWAASHSLEGAKTIAQAFLDKREQWNDIYGEG 155
>NAC2_CHLRE (Q9LEM8) PsbD mRNA maturation factor Nac2, chloroplast precursor| Length = 1385 Score = 28.1 bits (61), Expect = 5.3 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = -3 Query: 236 RLEEEGAVDILPLNTKCMNIIWKVE*MANNYEKIGRLLCQNT*KDSLSP 90 RL E A+D PLNTK +N+ + E +Y + L + D LSP Sbjct: 1039 RLLFERALDAHPLNTKIINMYARFEAEEGSYREAAELYDRALQIDPLSP 1087
>ARR7_ARATH (Q9ZWS7) Two-component response regulator ARR7| Length = 206 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 382 MKEKDKEIILRPLNMADLKEAKNQVAASFAAEGSIM 275 +KE +E +L+P+ +AD+K K + + A E I+ Sbjct: 127 LKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKIL 162
>CD48C_ARATH (Q9SS94) Cell division control protein 48 homolog C (AtCDC48c)| Length = 820 Score = 27.7 bits (60), Expect = 6.9 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -1 Query: 385 KMKEKDKEIILRPLNMADLKEAKNQVAASFAAEG-SIMGELKQWNDLYG 242 +M ++E+ + M+D +EA N V AS EG SI+ ++K W+D+ G Sbjct: 485 RMPWPEEELEKLFVKMSDFEEAVNLVQASLTREGFSIVPDVK-WDDVGG 532
>VP3_BTV2A (Q65748) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 13 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 114 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV1S (P56582) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 13 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 114 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV1A (P20608) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 13 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 114 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV17 (P03539) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 13 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 114 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV11 (Q65749) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 13 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 114 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>VP3_BTV10 (P12435) VP3 core protein (Major inner capsid protein)| Length = 901 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +1 Query: 13 KDLLCSADSLLVYKYNNQTQANYSLRGDRLSFHV 114 + L + + L+Y YN + Q NY G+ L F + Sbjct: 396 RQLDIALNDYLLYMYNTRVQVNYGPTGEPLDFQI 429
>HFE_RHIUN (Q9GL41) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 194 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 328 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>HFE_DICSU (Q9GL42) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 194 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 328 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>HFE_DICBI (Q9GL43) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 194 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 328 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>HFE_CERSI (Q9GKZ0) Hereditary hemochromatosis protein homolog precursor| Length = 348 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = +2 Query: 194 CSEEVCQLLLLPRAAFTIQIIPLLQLTHYGTFSSKTRRHLVLCFF 328 C E++ LL L R Q+ PL+++TH+ + T R L F+ Sbjct: 187 CPEQLQWLLELGRGVLDQQVPPLVKVTHHVASAVTTLRCQALNFY 231
>TRPB1_ARATH (P14671) Tryptophan synthase beta chain 1, chloroplast precursor| (EC 4.2.1.20) Length = 470 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 196 FRGSMSTAPSSSSRLHH 246 FR S+S+APSSSS+L H Sbjct: 10 FRASVSSAPSSSSQLTH 26 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,868,927 Number of Sequences: 219361 Number of extensions: 1035544 Number of successful extensions: 2625 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2624 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 1380984984 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)