Clone Name | rbastl09d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.... | 30 | 4.0 | 2 | MYO2_SACKL (Q875Q8) Myosin-2 (Class V unconventional myosin MYO2... | 28 | 8.9 | 3 | IF2_LACSS (Q38W81) Translation initiation factor IF-2 | 28 | 8.9 |
---|
>MQO_BLOFL (Q7VRS0) Probable malate:quinone oxidoreductase (EC 1.1.99.16)| (Malate dehydrogenase [acceptor]) (MQO) Length = 524 Score = 29.6 bits (65), Expect = 4.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -1 Query: 313 VSV*MDKLLLLSSPCWILHLFKEFEKPQREIRSYYQCAPT 194 +SV + L + P WI+H+++ KP +E + + A T Sbjct: 31 MSVTLGSFLTILEPSWIIHIYERLNKPAQESSNSWNNAGT 70
>MYO2_SACKL (Q875Q8) Myosin-2 (Class V unconventional myosin MYO2) (Type V myosin| heavy chain MYO2) (Myosin V MYO2) Length = 1554 Score = 28.5 bits (62), Expect = 8.9 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 6/90 (6%) Frame = +2 Query: 185 NYYCWSTLIIRTYLPLRLLKFFEKMQNPTGRRQQEQLIHSDRHLLHQNSGLHPIS----- 349 N+ W + Y RL ++ + Q P G + ++ + + L + + L I+ Sbjct: 1382 NFLSWKRGLQLNYNVTRLEEWCKSHQLPEGTECLQHMLQASKLLQLKKANLEDINIIWEI 1441 Query: 350 -SAA*PAQIVPLISYGNPATYTDEAPSQLL 436 S+ PAQI LIS A Y P ++L Sbjct: 1442 CSSLKPAQIQKLISQYAVADYEVPIPQEIL 1471
>IF2_LACSS (Q38W81) Translation initiation factor IF-2| Length = 937 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 268 NREKTARAAYPFRQTPASSKFRPP 339 N+EKT RAA+ + TPA+SK P Sbjct: 41 NQEKTLRAAFQTKATPAASKPATP 64 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,097,716 Number of Sequences: 219361 Number of extensions: 1161701 Number of successful extensions: 2429 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2429 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)