Clone Name | rbastl09a04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EBP2_ARATH (Q9LUJ5) Probable rRNA-processing protein EBP2 homolog | 31 | 1.3 | 2 | GOGA2_MOUSE (Q921M4) Golgin subfamily A member 2 (Cis-Golgi matr... | 30 | 3.9 | 3 | UBP2L_HUMAN (Q14157) Ubiquitin-associated protein 2-like | 29 | 6.7 | 4 | WRKY8_ARATH (Q9FL26) Probable WRKY transcription factor 8 (WRKY ... | 28 | 8.7 | 5 | TSP3_MOUSE (Q05895) Thrombospondin-3 precursor | 28 | 8.7 | 6 | TSP3_HUMAN (P49746) Thrombospondin-3 precursor | 28 | 8.7 |
---|
>EBP2_ARATH (Q9LUJ5) Probable rRNA-processing protein EBP2 homolog| Length = 293 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -3 Query: 371 PTCATGVHAGGQGHPSDHQGARHKQWEVVPWQDGGQGPAERQKIVGTTKDHK 216 P + G +GG+G P+ G + +++ + GG+ +Q TT D K Sbjct: 226 PGVSPGDRSGGKGRPTSRMGNKKREFRDSKFGHGGRKGLSKQNTAETTNDFK 277
>GOGA2_MOUSE (Q921M4) Golgin subfamily A member 2 (Cis-Golgi matrix protein| GM130) Length = 888 Score = 29.6 bits (65), Expect = 3.9 Identities = 20/78 (25%), Positives = 35/78 (44%) Frame = -3 Query: 437 RKTSSGGNNQRPH*PEALLEIPPTCATGVHAGGQGHPSDHQGARHKQWEVVPWQDGGQGP 258 + +++GGN Q H E ++ + + + Q Q A + + E WQ Q Sbjct: 244 QSSAAGGNEQLQHAMEERAQLETHVSQLMESLKQLQVERDQYAENLKGESAMWQQRVQQM 303 Query: 257 AERQKIVGTTKDHKERSV 204 AE+ + K+H+ER V Sbjct: 304 AEQVHTLKEEKEHRERQV 321
>UBP2L_HUMAN (Q14157) Ubiquitin-associated protein 2-like| Length = 983 Score = 28.9 bits (63), Expect = 6.7 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = -3 Query: 338 QGHPSDHQGARHKQWEVVPWQDGGQGPAERQKIVGTTKDHKERSVIAGRDHDHEKKRG 165 +G+P H WE+V + G G QK G T+ ++E RD D+ ++RG Sbjct: 88 EGNPDTHS------WEMVGKKKGVSG----QKDGGQTESNEEGKENRDRDRDYSRRRG 135
>WRKY8_ARATH (Q9FL26) Probable WRKY transcription factor 8 (WRKY DNA-binding| protein 8) Length = 326 Score = 28.5 bits (62), Expect = 8.7 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 5/64 (7%) Frame = -3 Query: 332 HPSDHQGARHKQWEVVPWQDGGQGPAERQKIVGTTKDHKER-----SVIAGRDHDHEKKR 168 HP + G K+ EV +DGG+ QK+V T K +++ S + + DH + Sbjct: 129 HPGEDSGKIRKKREV---RDGGEDDQRSQKVVKTKKKEEKKKEPRVSFMTKTEVDHLEDG 185 Query: 167 GRYR 156 R+R Sbjct: 186 YRWR 189
>TSP3_MOUSE (Q05895) Thrombospondin-3 precursor| Length = 956 Score = 28.5 bits (62), Expect = 8.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 259 GPCPPSCQGTTSHC 300 GPCPP QG +HC Sbjct: 301 GPCPPGLQGNGTHC 314
>TSP3_HUMAN (P49746) Thrombospondin-3 precursor| Length = 956 Score = 28.5 bits (62), Expect = 8.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 259 GPCPPSCQGTTSHC 300 GPCPP QG +HC Sbjct: 301 GPCPPGLQGNGTHC 314 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,608,570 Number of Sequences: 219361 Number of extensions: 1352297 Number of successful extensions: 3948 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3943 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)