Clone Name | rbastl06g11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) ... | 30 | 1.7 | 2 | SYGA_RICCN (Q92G10) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 28 | 6.3 | 3 | SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1... | 28 | 6.3 |
---|
>DEF2_COXBU (Q83AK6) Peptide deformylase 2 (EC 3.5.1.88) (PDF 2) (Polypeptide| deformylase 2) Length = 209 Score = 30.0 bits (66), Expect = 1.7 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 122 IEGCSSIYARFGIGSKEIHLLLSVWVY 42 IEGC S+ + G+ + +H+ L+ W+Y Sbjct: 98 IEGCLSVPGKVGVVERYVHVELTAWLY 124
>SYGA_RICCN (Q92G10) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 288 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 3 LQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 122 +Q S PG +R +HPNR Q KPS D LY Sbjct: 56 VQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQELY 95
>SYGA_RICPR (Q9ZCB0) Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)| (Glycine--tRNA ligase alpha chain) (GlyRS) Length = 289 Score = 28.1 bits (61), Expect = 6.3 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 3 LQHSILPG*NRLHIHPNRQQQVDLLATNTKPSIDR*ASLY 122 +Q S PG +R +HPNR Q KPS D LY Sbjct: 56 VQPSRRPGDSRYGMHPNRMQHYYQFQVILKPSPDNIQDLY 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,617,257 Number of Sequences: 219361 Number of extensions: 731910 Number of successful extensions: 1654 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1654 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)