ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl06g10 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 65.9 bits (159), Expect = 2e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADG 235 +RWYNFDDSH+S INE++VKSGAAYVLFYRR ++A G Sbjct: 885 SRWYNFDDSHISHINEDDVKSGAAYVLFYRRKSDAGG 921
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +WY FDDS VS +E+++ S AAYVLFY+R Sbjct: 903 KWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 43.5 bits (101), Expect = 1e-04 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +WY FDDS VS +E+++ S AAYVLFY+R Sbjct: 903 KWYYFDDSSVSTASEDQIVSKAAYVLFYQR 932
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 43.5 bits (101), Expect = 1e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +W+ FDD+ VS +NE +++S AAYVLFY+R Sbjct: 857 QWHYFDDNSVSPVNENQIESKAAYVLFYQR 886
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +WY FDDS+VS +E+++ + AAYVLFY+R Sbjct: 893 KWYYFDDSNVSLASEDQIVTKAAYVLFYQR 922
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 42.7 bits (99), Expect = 2e-04 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 244 N WY FDD V+ ++E V++ AYVLFYR+ +E Sbjct: 684 NLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSE 717
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 42.7 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 29/43 (67%), Gaps = 1/43 (2%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEADGAASNGT 217 +WY FDDS VS +E+++ + AAYVLFY RR E +S G+ Sbjct: 892 KWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDDECSSTSSLGS 934
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 41.2 bits (95), Expect = 6e-04 Identities = 16/30 (53%), Positives = 24/30 (80%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +W+ DD+ VS +NE +++S AAYVLFY+R Sbjct: 735 QWHYLDDNSVSPVNENQIESKAAYVLFYQR 764
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 41.2 bits (95), Expect = 6e-04 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTEADGAASNGTQSCVK 202 N+WY FDDS V+ E +G+AY+LFY RR + +G S+ Q ++ Sbjct: 1079 NKWYYFDDSRVTETAPENSIAGSAYLLFYIRRHKDGNGLGSSKLQEIIQ 1127
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY 259 RW+ FDD VS I+ VKS AAY+LFY Sbjct: 1079 RWFKFDDHEVSDISVSSVKSSAAYILFY 1106
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 244 +WY FDD +V+ ++E V++ YVLFYR+ +E Sbjct: 654 QWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSE 686
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 39.3 bits (90), Expect = 0.002 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY 259 RW+ FDD VS I+ V+S AAY+LFY Sbjct: 1041 RWFKFDDHEVSDISVSSVRSSAAYILFY 1068
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 37.7 bits (86), Expect = 0.007 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRRVT 247 ++Y FDDS V+ + EE + AAY+LFYRR T Sbjct: 947 QFYCFDDSRVTPVCPEETVTSAAYLLFYRRKT 978
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 37.0 bits (84), Expect = 0.012 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY 259 +W+ F+DS VS+I++EEV AY+LFY Sbjct: 438 QWFKFNDSMVSSISQEEVLKEQAYLLFY 465
>UBP11_CANFA (Q01988) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 445 Score = 36.6 bits (83), Expect = 0.016 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -3 Query: 330 FDDSHVSAINEEEVKSGAAYVLFYRR 253 FDD+ VS + E +++S AAYVLFY+R Sbjct: 386 FDDNSVSPVTENQIESKAAYVLFYQR 411
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 36.6 bits (83), Expect = 0.016 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 W FDDS V+ ++E +V + AYVLFYRR Sbjct: 1238 WRLFDDSTVTTVDESQVVTRYAYVLFYRR 1266
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 35.8 bits (81), Expect = 0.027 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY 259 RW++F+DS V+ +EE V AY+LFY Sbjct: 481 RWFHFNDSTVTVTDEETVGKAKAYILFY 508
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 35.4 bits (80), Expect = 0.035 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 244 W+ ++DS VS ++E +V S YVLFY+ + E Sbjct: 530 WHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 561
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 35.4 bits (80), Expect = 0.035 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRRVTE 244 W+ ++DS VS ++E +V S YVLFY+ + E Sbjct: 529 WHVYNDSRVSPVSENQVASSEGYVLFYQLMQE 560
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 35.4 bits (80), Expect = 0.035 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY 259 RW++F+DS V+ +EE V AY+LFY Sbjct: 482 RWFHFNDSTVTLTDEETVVKAKAYILFY 509
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 35.4 bits (80), Expect = 0.035 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRRV 250 WYN D++V ++ E+V AY+LFY R+ Sbjct: 928 WYNVSDAYVRQVSLEKVLHSEAYILFYERI 957
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 34.7 bits (78), Expect = 0.060 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 250 +W++ D+HV A+ +V + AY+LFY R+ Sbjct: 792 QWFHISDTHVQAVPTTKVLNSQAYLLFYERI 822
>UBP1_ARATH (Q9FPT5) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) (AtUBP1) Length = 1083 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRRV 250 WY+ DS V + EEV AY+LFY R+ Sbjct: 1054 WYHASDSQVRPASLEEVLRSEAYILFYERI 1083
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFY 259 + W++F+DS V+ ++ V+S AY+LFY Sbjct: 320 SEWHSFNDSRVTPMSSSHVRSSDAYLLFY 348
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 33.1 bits (74), Expect = 0.17 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVK 286 +WY+FDD HVS I +E++K Sbjct: 515 QWYSFDDQHVSRITQEDIK 533
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFY 259 N+W+ DD+ + + E EV + AY+LFY Sbjct: 404 NQWFLLDDTTIVEVKESEVLNSQAYLLFY 432
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 32.7 bits (73), Expect = 0.23 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYR 256 ++ FDD+ + I+ E++ + +AYVLFYR Sbjct: 819 FFKFDDTAICEIDPEDIVTSSAYVLFYR 846
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 32.3 bits (72), Expect = 0.30 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +WY ++DS ++ +E+ + +AY+LFY + Sbjct: 1339 KWYCYNDSSCEELHPDEIDTDSAYILFYEQ 1368
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 32.3 bits (72), Expect = 0.30 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 +WY ++DS ++ +E+ + +AY+LFY + Sbjct: 1537 KWYCYNDSSCKELHPDEIDTDSAYILFYEQ 1566
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 32.0 bits (71), Expect = 0.39 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFY 259 W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 570 WHTFNDSSVTPMSSSQVRTSDAYLLFY 596
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 32.0 bits (71), Expect = 0.39 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFY 259 W+ F+DS V+ ++ +V++ AY+LFY Sbjct: 318 WHTFNDSSVTPMSSSQVRTSDAYLLFY 344
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 31.6 bits (70), Expect = 0.51 Identities = 10/20 (50%), Positives = 17/20 (85%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVK 286 ++WY+F+D HVS I +E++K Sbjct: 514 DQWYSFNDQHVSRITQEDIK 533
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 31.6 bits (70), Expect = 0.51 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 250 +WY +DS V + N + V + AYVLFY R+ Sbjct: 393 QWYQMNDSLVHSSNVKVVLNQQAYVLFYLRI 423
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 31.2 bits (69), Expect = 0.66 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 WY F+D++ + + + + AY+LFY R Sbjct: 433 WYEFNDTYTGKVTDNHIVNQNAYILFYIR 461
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 WY +DS VS + V S AYVLFY R Sbjct: 383 WYQMNDSIVSTSDIRSVLSQQAYVLFYIR 411
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 7/38 (18%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKS-------GAAYVLFYRR 253 N+WY F+D+ VS + E V + AYVLFYR+ Sbjct: 887 NQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQ 924
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 30.4 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 250 N+W D V + +EV S +AY+LFY RV Sbjct: 471 NQWLWVSDDTVRKASLQEVLSSSAYLLFYERV 502
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEV----KSGAAYVLFYRRV 250 N W DD V IN+ +V AY+L+YRRV Sbjct: 760 NGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRV 795
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 6/38 (15%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEE------EVKSGAAYVLFYRRV 250 ++WY FDD V A + ++ S YVLFY RV Sbjct: 1032 SKWYYFDDEVVKADRKHGSDKNLKISSSDVYVLFYERV 1069
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFY-RRVTE 244 W + +DS +S +EV AY+LFY +RVTE Sbjct: 649 WVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTE 681
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 4/36 (11%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEV----KSGAAYVLFYRRV 250 N W DD V IN+ +V AY+L+YRRV Sbjct: 754 NGWLRIDDQTVKVINQYQVVKPPADRTAYLLYYRRV 789
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 8/46 (17%) Frame = -3 Query: 339 WYNFDDSHVSAINE--------EEVKSGAAYVLFYRRVTEADGAAS 226 W FDD +V+ +NE ++ AYVLFY E D S Sbjct: 387 WVLFDDENVTPVNENYLQRFFGDQPGQATAYVLFYTAADEEDDDVS 432
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 8/39 (20%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSG--------AAYVLFYRR 253 N+WY DD +++ + +++V G AY+L Y++ Sbjct: 872 NKWYRIDDVNITELEDDDVLKGGEEASDSRTAYILMYQK 910
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 7/37 (18%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEV-------KSGAAYVLFYR 256 N+WY F+D VS + +E++ +S +A +L Y+ Sbjct: 459 NKWYKFNDDKVSVVEKEKIESLAGGGESDSALILMYK 495
>UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) (Fragment) Length = 1140 Score = 29.6 bits (65), Expect = 1.9 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 5/36 (13%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSG-----AAYVLFYRRVT 247 W++ +DS V I E+++ +AY+LFYR+ T Sbjct: 448 WFDINDSKVHPIREKDITQQFQGKESAYMLFYRKAT 483
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFY 259 +WY DD+ V+ + V + AYVLFY Sbjct: 318 KWYKMDDTKVTRCDVTSVLNENAYVLFY 345
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 28.9 bits (63), Expect = 3.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRRVT 247 W + +DS + + EEV AY+LFY R T Sbjct: 625 WVHCNDSKLDVCSVEEVCKTQAYILFYTRRT 655
>UBP5_YEAST (P39944) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) Length = 805 Score = 28.9 bits (63), Expect = 3.3 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 339 WYNFDDSHVSAIN-EEEVKSGAAYVLFYRRV 250 WY FDDS I E + +AYVLFY R+ Sbjct: 774 WYFFDDSLYRPITFSTEFITPSAYVLFYERI 804
>CA036_HUMAN (Q7Z3Z2) Protein C1orf36| Length = 195 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 122 KRNQRGSSKIAKVCNNSDYLWLDLRLRFTHDWVPL 226 ++ + S+ + KVC DY WL R T+D P+ Sbjct: 42 RQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPI 76
>FOSL1_MOUSE (P48755) Fos-related antigen 1 (FRA-1)| Length = 273 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 55 FRPSCIAAISYGLTPKPCNSAHKK 126 F PS + +Y TP+PC+SAH+K Sbjct: 231 FTPSLV--FTYPSTPEPCSSAHRK 252
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 7/35 (20%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEV--KSG-----AAYVLFY 259 +W FDD HV+ ++EE + SG +AYVL Y Sbjct: 421 KWRLFDDEHVTVVDEEAILKTSGGGDWHSAYVLLY 455
>FOSL1_RAT (P10158) Fos-related antigen 1 (FRA-1)| Length = 275 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 55 FRPSCIAAISYGLTPKPCNSAHKK 126 F PS + +Y TP+PC+SAH+K Sbjct: 233 FTPSLV--FTYPSTPEPCSSAHRK 254
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVKSGAAYVLFYRR 253 NRW F+D HV E+ Y+ FY+R Sbjct: 806 NRWIKFNDRHVQL--SEQPPKELGYIYFYKR 834
>RGYR2_SULSO (Q97ZF5) Reverse gyrase 2 [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1166 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = +3 Query: 33 LIVFLTPFPSKLYSRNILWSHTETLQFRTQK--GTKGVLLKLRRYATTQI 176 L+ P +LY+RNI+ ++TE L K G+ G++L + Y +++ Sbjct: 279 LLTGFEPSSIQLYARNIIDAYTENLDLSIVKELGSGGLILVSKEYGRSKL 328
>DISI_AGKCO (Q9IAB0) Zinc metalloproteinase contortrostatin precursor (EC| 3.4.24.-) [Contains: Disintegrin contortrostatin] Length = 483 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 103 VSV*DHRILRLYNLDGKGVRNTIRSWLHE 17 V V DHR+ YN G NTIR W+HE Sbjct: 203 VVVADHRMFTKYN----GNLNTIRIWVHE 227
>DISB_AGKPI (Q805F4) Zinc metalloproteinase piscivostatin-beta precursor (EC| 3.4.24.-) [Contains: Disintegrin piscivostatin-beta] Length = 483 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = -2 Query: 103 VSV*DHRILRLYNLDGKGVRNTIRSWLHE 17 V V DHR+ YN G NTIR W+HE Sbjct: 203 VVVADHRMFTKYN----GNLNTIRIWVHE 227
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 28.1 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 339 WYNFDDSHVSAINEEEVKSGAAYVLFYRRVTEADGAASNGT 217 W + +DS ++ + EEV AY+LFY + T A + T Sbjct: 628 WVHCNDSKLNVCSVEEVCKTQAYILFYTQRTVQGNARISET 668
>Y512_CHLPN (Q9Z840) Protein CPn_0512/CP0242/CPj0512/CpB0533| Length = 620 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 336 YNFDDS-HVSAINEEEVKSGAAYVLFYRRVTEADGA 232 Y +DD +S++ ++ A +V +Y RVT+AD A Sbjct: 573 YEYDDMVPLSSVTLKDPNGKAPFVFYYLRVTQADNA 608
>LRRK1_MOUSE (Q3UHC2) Leucine-rich repeat serine/threonine-protein kinase 1 (EC| 2.7.11.1) Length = 2014 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 39 VFLTPFPSKLYSRNILWSHTETLQFRTQKGTKGVLLKLRRY 161 +F+T FP++L+ N HTE +G G ++ RY Sbjct: 1222 LFMTDFPARLFLENSKLEHTEGENSILGQGGSGTVIYQARY 1262
>UBP4_YEAST (P32571) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Vacuole biogenesis protein SSV7) Length = 926 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 339 WYNFDDSHVSAI-NEEEVKSGAAYVLFYRRV 250 W FDD+ + N+ + + AYVLFY RV Sbjct: 893 WLYFDDTKYKPVKNKADAINSNAYVLFYHRV 923
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 27.7 bits (60), Expect = 7.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 342 RWYNFDDSHVSAINEEEVKSGAAYVLFYRRV 250 RW D+ V + +EV AY+LFY RV Sbjct: 845 RWLYISDNIVRESSWDEVSKVEAYMLFYERV 875
>FOSL1_HUMAN (P15407) Fos-related antigen 1 (FRA-1)| Length = 271 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 55 FRPSCIAAISYGLTPKPCNSAHKK 126 F PS + +Y TP+PC SAH+K Sbjct: 229 FTPSLV--FTYPSTPEPCASAHRK 250
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 17/49 (34%) Frame = -3 Query: 345 NRWYNFDDSHVSAINEEEVK-----------------SGAAYVLFYRRV 250 N W+ F+D +V++I +E+++ S AY+L YR+V Sbjct: 731 NEWFCFNDQNVTSITQEDIQRSFGGPNGSYYSSAYTSSTNAYMLMYRQV 779 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,330,482 Number of Sequences: 219361 Number of extensions: 951235 Number of successful extensions: 3245 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 3202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3243 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
