| Clone Name | rbastl06f08 |
|---|---|
| Clone Library Name | barley_pub |
>Y2022_MYCBO (P63350) Hypothetical transport protein Mb2022c| Length = 440 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 387 LVCLVGTSTSRLRLANDRYAAYWLMAIH 304 L ++G S + L +A DR+ WL A+H Sbjct: 290 LALILGVSRTTLAMARDRHLPRWLAAVH 317
>Y1999_MYCTU (P63349) Hypothetical transport protein Rv1999c/MT2055| Length = 440 Score = 28.5 bits (62), Expect = 4.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 387 LVCLVGTSTSRLRLANDRYAAYWLMAIH 304 L ++G S + L +A DR+ WL A+H Sbjct: 290 LALILGVSRTTLAMARDRHLPRWLAAVH 317
>MYADM_HUMAN (Q96S97) Myeloid-associated differentiation marker (SB135)| Length = 322 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 138 RTMATSCCNK*VYSVCCWNMYLAISVL--VNLIGF 40 R+ SC Y VC W+ LA+++L +NL+ + Sbjct: 273 RSRDVSCSRSHAYYVCAWDRRLAVAILTAINLLAY 307
>MTH11_DROME (P83118) Probable G-protein coupled receptor Mth-like 11 precursor| (Protein methuselah-like 11) Length = 510 Score = 28.1 bits (61), Expect = 5.3 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -2 Query: 138 RTMATSCCNK*VYSVCCWNMYLAISVLVNLIGFYGVLSL 22 R++ CCN +Y +C LAI+ L+N+I +G+ L Sbjct: 254 RSLHGKCCN--LYFIC-----LAITFLLNVISLFGIFEL 285
>SF3B1_SCHPO (Q10178) U2 snRNP component prp10| Length = 1188 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 217 QHKSTNGGERI*STREQRGLNYSTHLIKLMN 309 ++ STNG I T++ L Y+ HL K N Sbjct: 27 KNSSTNGSVNIEGTQDSNDLQYNAHLFKSSN 57
>ANPRC_MOUSE (P70180) Atrial natriuretic peptide clearance receptor precursor| (ANP-C) (ANPRC) (NPR-C) (Atrial natriuretic peptide C-type receptor) (EF-2) Length = 536 Score = 27.7 bits (60), Expect = 6.9 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -1 Query: 133 YGDFXXXXXXXXXXXLEHVFGYFSSSQLNWLLRSIISYKFGPSK 2 YGDF + V G + + + +RS + Y +GP K Sbjct: 408 YGDFSVVAMTDTEAGTQEVIGDYFGKEGRFQMRSNVKYPWGPLK 451
>MYADM_PONPY (Q5R6H1) Myeloid-associated differentiation marker| Length = 322 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 138 RTMATSCCNK*VYSVCCWNMYLAISVL--VNLIGF 40 R+ SC Y VC W+ LA+++L +NL+ + Sbjct: 273 RSRDVSCSRSHAYYVCGWDRRLAVAILTAINLLAY 307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,321,382 Number of Sequences: 219361 Number of extensions: 922301 Number of successful extensions: 1501 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1501 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)