Clone Name | rbastl06f01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotrans... | 31 | 1.5 | 2 | MURE_LISMO (Q8Y5L9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-... | 29 | 5.5 | 3 | PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-) | 28 | 7.2 | 4 | TAF1C_HUMAN (Q15572) TATA box-binding protein-associated factor ... | 28 | 9.4 |
---|
>GLMS_TREPA (O83833) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 634 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 256 CN*LQSCLVARMDRHATCTHSGGHVGVELVVSFDLKLICICI 131 CN +S LV D TH+G +GV SF +L+C+ + Sbjct: 387 CNGARSTLVRESDA-VLLTHAGSEIGVASTKSFTTQLVCLLV 427
>MURE_LISMO (Q8Y5L9) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 491 Score = 28.9 bits (63), Expect = 5.5 Identities = 22/95 (23%), Positives = 40/95 (42%), Gaps = 6/95 (6%) Frame = +2 Query: 113 NFQYTLDTYTNKLKVKRHHQFNSYMSTRVGTSGMPVHSGNQTRLQLVTA---LVDGIKMF 283 ++ +T++ Y N + NSY ++ + + R+Q TA + GIK Sbjct: 205 DYHHTMEEYANAKSLLFAQLGNSYHTSNPKIAVLNADDAESVRMQKATAAHIITFGIKQE 264 Query: 284 LDEPPANAEV*EHSEGSSVTT---TFTSEHAMLGN 379 D +N ++ H + T FT + M+GN Sbjct: 265 ADFQASNIKITSHGSTFDLGTPVGNFTLKIKMIGN 299
>PHSA_SALTY (P37600) Thiosulfate reductase precursor (EC 1.-.-.-)| Length = 758 Score = 28.5 bits (62), Expect = 7.2 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +3 Query: 99 SSKDVTFSTHLIHIQISLRSKDTTSSTPTCP 191 SSK + S+HL H+ + S +T + TCP Sbjct: 145 SSKSGSLSSHLFHLATAFGSPNTFTHASTCP 175
>TAF1C_HUMAN (Q15572) TATA box-binding protein-associated factor RNA polymerase| I subunit C (TATA box-binding protein-associated factor 1C) (TBP-associated factor 1C) (TBP-associated factor RNA polymerase I 110 kDa) (TAFI110) Length = 869 Score = 28.1 bits (61), Expect = 9.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 290 EPPANAEV*EHSEGSSVTTTFTSEHAMLGNSKTCIRSKPR 409 + P A HS+ SSV T + +H + +S +R KPR Sbjct: 827 DTPGCATTPPHSQASSVRATRSQQHTPVLSSSQPLRKKPR 866 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,179,077 Number of Sequences: 219361 Number of extensions: 1397715 Number of successful extensions: 3460 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3460 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)