Clone Name | rbastl06b10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CP391_DROME (Q9VQD2) Probable cytochrome P450 309a1 (EC 1.14.-.-... | 29 | 3.4 | 2 | SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 28 | 7.7 | 3 | DJLA_SHEON (Q8EB99) DnaJ-like protein djlA | 28 | 7.7 | 4 | GATD_METAC (Q8TR66) Glutamyl-tRNA(Gln) amidotransferase subunit ... | 28 | 7.7 |
---|
>CP391_DROME (Q9VQD2) Probable cytochrome P450 309a1 (EC 1.14.-.-) (CYPCCCIXA1)| Length = 529 Score = 28.9 bits (63), Expect = 3.4 Identities = 19/59 (32%), Positives = 27/59 (45%) Frame = -3 Query: 219 IGEAEKKLDA*SGSAFESALCFYWDLLAFFVWKLILHLFFADGGDVTFIENSNGTMKLQ 43 IG+ +K S AF S + F L+A FV KL FF D F+ + + L+ Sbjct: 236 IGDFQKTSTDWSAHAFSSMIRFNKTLVAIFVRKLFSMRFFTKATDEFFLRLTQDAVNLR 294
>SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1217 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 297 YREKAPPSVQEEDMRKLTAFFEQLRVIGEA 208 Y+EK P VQE+D KL +L + EA Sbjct: 1180 YKEKVPVKVQEQDTEKLRQSQTELEKVKEA 1209
>DJLA_SHEON (Q8EB99) DnaJ-like protein djlA| Length = 262 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 300 GYREKAPPSVQEEDMRKLTAFFEQLRVIGEAEKK 199 G+ KA V E D+R T +Q+R+ G+A K+ Sbjct: 65 GHVAKASGRVTETDIRIATLLMDQMRLTGDARKE 98
>GATD_METAC (Q8TR66) Glutamyl-tRNA(Gln) amidotransferase subunit D (EC 6.3.5.-)| (Glu-ADT subunit D) Length = 424 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 Query: 214 TDDPQLLEKGGELPHVLLLDTGGSLLS 294 T++ +L E G +LP + +L TGG++ S Sbjct: 71 TNEEELPEPGKKLPKIAILSTGGTIAS 97 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,742,676 Number of Sequences: 219361 Number of extensions: 765041 Number of successful extensions: 2223 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2222 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)