| Clone Name | rbastl06b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ESR2_MICUN (P57781) Estrogen receptor beta (ER-beta) | 31 | 0.69 | 2 | YG2A_YEAST (P53243) Putative 91.0 kDa zinc finger protein in SPT... | 29 | 3.4 | 3 | MUTS_BACFN (Q5L7B7) DNA mismatch repair protein mutS | 28 | 4.5 | 4 | MUTS_BACFR (Q64MG7) DNA mismatch repair protein mutS | 28 | 4.5 | 5 | YAL1_EBV (P03229) Hypothetical protein BALF1 | 28 | 7.7 | 6 | YRY4_CAEEL (Q09354) Hypothetical protein T15H9.4 | 28 | 7.7 | 7 | L_PI2HT (P26676) Large structural protein (Protein L) (Transcrip... | 28 | 7.7 |
|---|
>ESR2_MICUN (P57781) Estrogen receptor beta (ER-beta)| Length = 673 Score = 31.2 bits (69), Expect = 0.69 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 105 STNWPQNRQPCVPNLTQLCPNIYIHTKSSSHS 200 S WP + P +P+LT CP ++ + S H+ Sbjct: 99 SAFWPSHNHPTMPSLTLHCPESIVYNEPSPHA 130
>YG2A_YEAST (P53243) Putative 91.0 kDa zinc finger protein in SPT4-ROM1| intergenic region Length = 794 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +3 Query: 159 CPNIYIHTKSSSHSLRTELYFSASEEVDVILLINFFSFML 278 C N+Y + + TE S +E+ DV LI F+S ++ Sbjct: 242 CTNLYASSSKHDNDFDTEDILSQTEQHDVFALILFYSLLV 281
>MUTS_BACFN (Q5L7B7) DNA mismatch repair protein mutS| Length = 879 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 292 SGSDYSMKLKKLMSKITSTSSLAEKYNSV 206 SG DY +K+++ S++T SL YNSV Sbjct: 450 SGKDYLLKIQQRESELTGIPSLKIAYNSV 478
>MUTS_BACFR (Q64MG7) DNA mismatch repair protein mutS| Length = 862 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 292 SGSDYSMKLKKLMSKITSTSSLAEKYNSV 206 SG DY +K+++ S++T SL YNSV Sbjct: 433 SGKDYLLKIQQRESELTGIPSLKIAYNSV 461
>YAL1_EBV (P03229) Hypothetical protein BALF1| Length = 220 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -3 Query: 96 YQFWLKCGCVVGYRVYFAVQNLVVDH 19 Y +W + V+ Y V FAV+N + DH Sbjct: 143 YDYWSRLRVVLCYTVVFAVRNYLDDH 168
>YRY4_CAEEL (Q09354) Hypothetical protein T15H9.4| Length = 431 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +3 Query: 132 PCVPNLTQLCPNIYIHTKSSSHSLRTELYFSASEEVDVILLIN 260 P P + CP + KS+++++ +YF S V +L++ Sbjct: 333 PTAPGSAEGCPPPLVKAKSTTNAIERSVYFPLSTTAAVAILVS 375
>L_PI2HT (P26676) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2262 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 213 IRCAVSESWILCVYIC*DIVESSWAHMAAD 124 I+C ESWIL + + SWA +AAD Sbjct: 972 IKCGALESWILYNLLARKPGKGSWATLAAD 1001 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,372,044 Number of Sequences: 219361 Number of extensions: 793558 Number of successful extensions: 1956 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1956 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)