| Clone Name | rbastl06b01 |
|---|---|
| Clone Library Name | barley_pub |
>LIFO_ACILW (Q9X2S4) Lipase chaperone (Lipase foldase) (Lipase helper protein)| (Lipase activator protein) (Lipase modulator) Length = 346 Score = 30.4 bits (67), Expect = 1.2 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 11 GQQKNNINVTCKLIPTHAMLCQARCDSGRYNIKFGNMLHMNMFNPQNECLHNAQN 175 G + NN++ K++ A + Q ++ N FGN ++N FN + +H +N Sbjct: 156 GFKSNNVDALQKVVDQMAKVQQQFFNAAEINALFGNERNLNQFNLEQMRIHANKN 210
>LPXB_CHLTR (O84416) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 607 Score = 30.0 bits (66), Expect = 1.6 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 126 WSIFPNLI-L*RPESHLAWHSIACVGISLHVTLILFFCW 13 W PN++ L PE+ L+W I C+G+++ +L F W Sbjct: 122 WMASPNILHLNLPEASLSWQLIGCIGLTI-FSLRFFIQW 159
>COX1_PROWI (Q05143) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 514 Score = 29.3 bits (64), Expect = 2.7 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 8/67 (11%) Frame = -1 Query: 195 PMTLPK-QFWALCRHSFWGLNIFMWSI-------FPNLIL*RPESHLAWHSIACVGISLH 40 P TL + FW + F G+NI + + P I P+ + W+++A G L Sbjct: 405 PETLGQIHFWLM----FLGVNITFFPMHFLGLAGMPRRIPDYPDCYAGWNAVASYGSYLS 460 Query: 39 VTLILFF 19 +T +LFF Sbjct: 461 ITAVLFF 467
>CBIO3_STAAR (Q6GDC0) Putative cobalt import ATP-binding protein cbiO 3| Length = 570 Score = 28.9 bits (63), Expect = 3.6 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 4/66 (6%) Frame = +2 Query: 77 ARCDSGRYNIKF-GNM---LHMNMFNPQNECLHNAQNCFGKVIGLSDQQADAGRYVIITY 244 A C +G K GN+ LH+N + CLH N G V+ +D G+++ +T Sbjct: 50 ANCINGLIPFKTKGNVTGELHINNQDATVSCLHKRSNVVGTVLQDTD-----GQFIGLTA 104 Query: 245 TNEMAF 262 +MAF Sbjct: 105 AEDMAF 110
>COX1_LEITA (P14544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 549 Score = 28.5 bits (62), Expect = 4.7 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 Query: 117 FPNLIL*RPESHLAWHSIACVGISLHVTLILFFC 16 FP I P S L W S G+ L +LILF C Sbjct: 438 FPRRISDYPVSFLFWSSFMLYGMLLLASLILFLC 471
>Y630_RICPR (Q9ZCT3) Hypothetical UPF0118 protein RP630| Length = 351 Score = 28.5 bits (62), Expect = 4.7 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = -3 Query: 217 ICLLI*KSYDFAKTVLGIVQALILGIKHIHVEHIPKLNIVAS 92 ICLL+ Y A T++GI AL+LGI + IP L S Sbjct: 211 ICLLLSTYYSIAFTLIGIDLALLLGILTGFLVIIPLLGTFIS 252
>LPXB_CHLMU (Q9PJY4) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 607 Score = 28.5 bits (62), Expect = 4.7 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -1 Query: 126 WSIFPNLI-L*RPESHLAWHSIACVGISLHVTLILFFCW 13 W PN++ L PE++ W I C+G+++ +L F W Sbjct: 122 WMASPNILHLNLPEANFLWQLIGCIGLTI-FSLRFFIQW 159
>LPXB_CHLPN (Q9Z6U3) Lipid-A-disaccharide synthase (EC 2.4.1.182)| Length = 604 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/29 (37%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 126 WSIFPNLI-L*RPESHLAWHSIACVGISL 43 W PN+ L P + L+WH I C+G+++ Sbjct: 117 WMASPNIFHLPLPPAQLSWHLIGCLGLAI 145
>CB025_HUMAN (Q9H3L0) Protein C2orf25, mitochondrial precursor| Length = 296 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 159 RHSFWGLNIFMWSIFPNLIL*RPESHL 79 RHS WG ++ + SIF N P+SH+ Sbjct: 266 RHSLWGTHVVVGSIFTNA---TPDSHI 289
>CB025_GECJA (Q6DV04) Protein C2orf25 homolog, mitochondrial precursor| Length = 296 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 159 RHSFWGLNIFMWSIFPNLIL*RPESHL 79 RHS WG ++ + SIF N P+SH+ Sbjct: 266 RHSLWGTHVVVGSIFTNA---TPDSHI 289 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,221,426 Number of Sequences: 219361 Number of extensions: 861726 Number of successful extensions: 1746 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1746 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)