>S6A18_HUMAN (Q96N87) Sodium- and chloride-dependent transporter XTRP2 (Solute|
           carrier family 6 member 18)
          Length = 628

 Score = 29.6 bits (65), Expect = 2.1
 Identities = 16/61 (26%), Positives = 26/61 (42%)
 Frame = -1

Query: 217 IQRWCWSDEAIGQLCFVSYLHSTCIFPKENNVWDKCSHFWLG*IYSIHISLKFYMLMFVS 38
           + RW   +   G +C V +L +TC   +  N       +WL    +   SL   ML F+ 
Sbjct: 435 LPRWVPKEALTGLVCLVCFLSATCFTLQSGN-------YWLEIFDNFAASLNLLMLAFLE 487

Query: 37  I 35
           +
Sbjct: 488 V 488


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 38,026,515
Number of Sequences: 219361
Number of extensions: 650598
Number of successful extensions: 1016
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1006
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1016
length of database: 80,573,946
effective HSP length: 68
effective length of database: 65,657,398
effective search space used: 1575777552
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)