ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl06a02 |
|---|---|
| Clone Library Name | barley_pub |
>INSRR_CAVPO (P14617) Insulin receptor-related protein precursor (EC 2.7.10.1)| (IRR) (IR-related receptor) [Contains: Insulin receptor-related protein alpha chain; Insulin receptor-related protein beta chain] Length = 1300 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETASNHVP 232 WQ++P LRP+F Q+ L ++Q+ + PS + + H P Sbjct: 1229 WQQNPRLRPTFTQI---LNSIQKELRPSFRLLSFYHSP 1263
>VGFR2_MOUSE (P35918) Vascular endothelial growth factor receptor 2 precursor (EC| 2.7.10.1) (VEGFR-2) (Protein-tyrosine kinase receptor flk-1) (Fetal liver kinase 1) (Kinase NYK) Length = 1367 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTL 283 W +DPN RPSF +L +L L Sbjct: 1141 WHEDPNQRPSFSELVEHLGNL 1161
>VGFR1_RAT (P53767) Vascular endothelial growth factor receptor 1 precursor (EC| 2.7.10.1) (VEGFR-1) (Tyrosine-protein kinase receptor FLT) (FLT-1) Length = 1336 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETASNHVPYEISLYR*TAHLTSLP 184 W KDP RP F +L L L + + Q+ +++P L R + S+P Sbjct: 1137 WHKDPKERPRFAELVEKLGDLLQANV---QQDGKDYIPLNAILTRNSGFTYSVP 1187
>EPHA3_RAT (O08680) Ephrin type-A receptor 3 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor REK4) (TYRO-4) Length = 984 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQR 277 WQKD N RP F Q+ S L L R Sbjct: 862 WQKDRNNRPKFEQIVSILDKLIR 884
>PGLR_PENGR (O93883) Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase)| Length = 376 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 62 VHTRSKAFACNSGVNAI*TGTQIWGQNHNYSLFTLGG 172 VH + A NSG N TG Q G H S+ ++GG Sbjct: 211 VHNQDDCLAVNSGTNVHFTGAQCTG-GHGISIGSVGG 246
>M3KL4_HUMAN (Q5TCX8) Mitogen-activated protein kinase kinase kinase (EC| 2.7.11.25) (Mixed lineage kinase 4) Length = 1036 Score = 28.1 bits (61), Expect = 5.4 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVI 268 WQ+DP++RPSF + L ++ V+ Sbjct: 381 WQQDPHIRPSFALILEQLTAIEGAVM 406
>VGFR1_MOUSE (P35969) Vascular endothelial growth factor receptor 1 precursor (EC| 2.7.10.1) (VEGFR-1) (Tyrosine-protein kinase receptor FLT) (FLT-1) (Embryonic receptor kinase 2) Length = 1333 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETASNHVPYEISLYR*TAHLTSLP 184 W KDP RP F +L L L + + Q+ +++P L R ++ S P Sbjct: 1137 WHKDPKERPRFAELVEKLGDLLQANV---QQDGKDYIPLNAILTRNSSFTYSTP 1187
>FYN_HUMAN (P06241) Proto-oncogene tyrosine-protein kinase Fyn (EC 2.7.10.2)| (p59-Fyn) (Protooncogene Syn) (SLK) Length = 536 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQ 256 W+KDP RP+F L S+L+ P +Q Sbjct: 502 WKKDPEERPTFEYLQSFLEDYFTATEPQYQ 531
>EPHA3_MOUSE (P29319) Ephrin type-A receptor 3 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor ETK1) (MEK4) Length = 983 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQR 277 WQKD N RP F Q+ S L L R Sbjct: 861 WQKDRNNRPKFEQIVSILDKLIR 883
>EPHA3_HUMAN (P29320) Ephrin type-A receptor 3 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor ETK1) (HEK) (HEK4) Length = 983 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQR 277 WQKD N RP F Q+ S L L R Sbjct: 861 WQKDRNNRPKFEQIVSILDKLIR 883
>EPHA3_CHICK (P29318) Ephrin type-A receptor 3 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor ETK1) (CEK4) Length = 983 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQR 277 WQKD N RP F Q+ S L L R Sbjct: 861 WQKDRNNRPKFEQIVSILDKLIR 883
>EPHA5_CHICK (P54755) Ephrin type-A receptor 5 precursor (EC 2.7.10.1)| (Tyrosine-protein kinase receptor CEK7) Length = 1013 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETASN 241 WQKD N RP F ++ S L L R PS +T N Sbjct: 891 WQKDRNSRPKFDEIVSMLDKLIR--NPSSLKTLVN 923
>YES_CANFA (Q28923) Proto-oncogene tyrosine-protein kinase Yes (EC 2.7.10.2)| (p61-Yes) (c-Yes) Length = 538 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQ 256 W+KDP+ RP+F + S+L+ P +Q Sbjct: 504 WKKDPDERPTFEYIQSFLEDYFTAAEPQYQ 533
>VGFR2_RAT (O08775) Vascular endothelial growth factor receptor 2 precursor (EC| 2.7.10.1) (VEGFR-2) (Protein-tyrosine kinase receptor flk-1) (Fetal liver kinase 1) Length = 1343 Score = 27.7 bits (60), Expect = 7.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTL 283 W +DPN RP+F +L +L L Sbjct: 1139 WHEDPNQRPAFSELVEHLGNL 1159
>YES_MOUSE (Q04736) Proto-oncogene tyrosine-protein kinase Yes (EC 2.7.10.2)| (p61-Yes) (c-Yes) Length = 540 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQ 256 W+KDP+ RP+F + S+L+ P +Q Sbjct: 506 WKKDPDERPTFEYIQSFLEDYFTATEPQYQ 535
>YES_CHICK (P09324) Tyrosine-protein kinase Yes (EC 2.7.10.2) (p61-Yes)| Length = 540 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQ 256 W+KDP+ RP+F + S+L+ P +Q Sbjct: 506 WKKDPDERPTFEYIQSFLEDYFTATEPQYQ 535
>IGF1R_PIG (Q29000) Insulin-like growth factor 1 receptor (EC 2.7.10.1)| (Insulin-like growth factor I receptor) (IGF-I receptor) (Fragments) Length = 304 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLK 289 WQ +P +RPSF+++ S +K Sbjct: 196 WQYNPKMRPSFLEIISSIK 214
>IGF1R_HUMAN (P08069) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) (CD221 antigen) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 recepto Length = 1367 Score = 27.7 bits (60), Expect = 7.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLK 289 WQ +P +RPSF+++ S +K Sbjct: 1249 WQYNPKMRPSFLEIISSIK 1267
>YES_HUMAN (P07947) Proto-oncogene tyrosine-protein kinase Yes (EC 2.7.10.2)| (p61-Yes) (c-Yes) Length = 542 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQ 256 W+KDP+ RP+F + S+L+ P +Q Sbjct: 508 WKKDPDERPTFEYIQSFLEDYFTATEPQYQ 537
>ADA18_HUMAN (Q9Y3Q7) ADAM 18 precursor (A disintegrin and metalloproteinase| domain 18) (Transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III) (tMDC III) Length = 739 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 375 SYSCINYT*LWQKDPNLRPSFIQLTSYLKTLQRLVIPSHQE 253 S +NY+ +WQKD +P + L S +K L +L +P + E Sbjct: 151 SILAVNYSHIWQKD---QPYKVPLNSQIKNLSKL-LPQYLE 187
>YES_XENLA (P10936) Tyrosine-protein kinase Yes (EC 2.7.10.2) (p61-Yes)| Length = 536 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQ 256 W+KDP+ RP+F + S+L+ P +Q Sbjct: 502 WKKDPDERPTFEYIQSFLEDYFTATEPQYQ 531
>YKS7_YEAST (P34231) Protein YKL187C| Length = 750 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 233 PMKYLYIGEPHISHLYPGVVIPQV 162 P+ +YIGE I H+ VIPQ+ Sbjct: 46 PLTNIYIGEADIKHINVSKVIPQI 69
>FAK2_RAT (P70600) Protein tyrosine kinase 2 beta (EC 2.7.10.2) (Focal| adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Cell adhesion kinase beta) (CAK beta) (Calcium-dependent tyrosine kinase) (CADTK) Length = 1009 Score = 27.3 bits (59), Expect = 9.2 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 5/68 (7%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLV--IPSHQETASNHVPYEI---SLYR*TAHLTSLPR 181 W DP+ RP F +L L + ++ I QE + + P +I + ++ S P+ Sbjct: 662 WDYDPSDRPRFTELVCSLSDIYQMERDIAIEQERNARYRPPKILEPTAFQEPPPKPSRPK 721 Query: 180 GCHPPSVN 157 HPP N Sbjct: 722 YKHPPQTN 729
>HTK7_HYDAT (Q25197) Putative insulin-like peptide receptor precursor (EC| 2.7.10.1) Length = 1477 Score = 27.3 bits (59), Expect = 9.2 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLK 289 W +DP +RPSF+++ L+ Sbjct: 1289 WHRDPKMRPSFLEIVHVLE 1307
>IGF1R_XENLA (O73798) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (xIGF-1R) (xIGFR) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1358 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLK 289 WQ +P +RPSF+++ S +K Sbjct: 1245 WQFNPKMRPSFLEIISSIK 1263
>IGF1R_MOUSE (Q60751) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1373 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETA 247 WQ +P +RPSF+++ +K PS QE + Sbjct: 1251 WQYNPKMRPSFLEIIGSIKDEME---PSFQEVS 1280
>IGF1R_BOVIN (Q05688) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] (F Length = 640 Score = 27.3 bits (59), Expect = 9.2 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLK 289 WQ +P +RPSF+++ S +K Sbjct: 522 WQYNPKMRPSFLEIISSVK 540
>EPHAA_HUMAN (Q5JZY3) Ephrin type-A receptor 10 precursor (EC 2.7.10.1)| Length = 1008 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTL 283 WQKDP RP F Q+ S L + Sbjct: 883 WQKDPGERPRFSQIHSILSKM 903
>SYG_STRCO (Q9L2H9) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 460 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -1 Query: 142 ILSPYLGPSLDSIHPAVASKSFAAGMYSTYRLIR*NSRRRKQY 14 +LS +LGP+ DS A A G+++ + ++ SRR+ + Sbjct: 142 LLSTHLGPTQDSGSVAYLRPETAQGIFTNFAQVQTTSRRKPPF 184
>SYG_STRAW (Q82BR9) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 460 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -1 Query: 142 ILSPYLGPSLDSIHPAVASKSFAAGMYSTYRLIR*NSRRRKQY 14 +LS +LGP+ DS A A G+++ + ++ SRR+ + Sbjct: 142 LLSTHLGPTQDSGSVAYLRPETAQGIFTNFAQVQQTSRRKPPF 184
>IGF1R_RAT (P24062) Insulin-like growth factor 1 receptor precursor (EC| 2.7.10.1) (Insulin-like growth factor I receptor) (IGF-I receptor) [Contains: Insulin-like growth factor 1 receptor alpha chain; Insulin-like growth factor 1 receptor beta chain] Length = 1370 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 345 WQKDPNLRPSFIQLTSYLKTLQRLVIPSHQETA 247 WQ +P +RPSF+++ +K PS QE + Sbjct: 1250 WQYNPKMRPSFLEIIGSIKDEME---PSFQEVS 1279
>GLYG3_SOYBN (P11828) Glycinin G3 precursor [Contains: Glycinin A subunit;| Glycinin B subunit] Length = 481 Score = 27.3 bits (59), Expect = 9.2 Identities = 23/81 (28%), Positives = 32/81 (39%) Frame = +1 Query: 16 IVFSSCCFILSAYMYCTYPQQSFCLQQRGECYLDWDPDMGTKS*LLLIHTWGMTTPG*RC 195 ++FS CCF A+ + PQQ+ C QR PD +S I TW +C Sbjct: 11 LLFSGCCF---AFSFREQPQQNECQIQRLNAL---KPDNRIESEGGFIETWNPNNKPFQC 64 Query: 196 EMCGSPI*RYFIGYMIARCLL 258 G ++RC L Sbjct: 65 -----------AGVALSRCTL 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,606,821 Number of Sequences: 219361 Number of extensions: 1112699 Number of successful extensions: 2400 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 2358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2400 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
