Clone Name | rbastl05h10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DADA_PHOLL (Q7N3Z6) D-amino acid dehydrogenase small subunit (EC... | 30 | 1.8 | 2 | LAMC3_MOUSE (Q9R0B6) Laminin gamma-3 chain precursor (Laminin 12... | 28 | 4.0 | 3 | NOTC1_HUMAN (P46531) Neurogenic locus notch homolog protein 1 pr... | 27 | 9.0 |
---|
>DADA_PHOLL (Q7N3Z6) D-amino acid dehydrogenase small subunit (EC 1.4.99.1)| Length = 436 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 236 TKTHFWVSWCHLAPMWLELYIPTGHHCRTNVFRTTGHHCRRW 111 T+THFW + P + PT +H N++ TGH W Sbjct: 346 TQTHFWTGLRPMTPDGTPIVGPTEYH---NLYLNTGHGTLGW 384
>LAMC3_MOUSE (Q9R0B6) Laminin gamma-3 chain precursor (Laminin 12 gamma 3| subunit) Length = 1581 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = -1 Query: 185 ELYIPTGH--HCRTNVFRTTGHHCRR 114 ELY TGH HC+ TTG HC R Sbjct: 350 ELYRSTGHGGHCQRCRDHTTGPHCER 375
>NOTC1_HUMAN (P46531) Neurogenic locus notch homolog protein 1 precursor (Notch| 1) (hN1) (Translocation-associated notch protein TAN-1) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2556 Score = 27.3 bits (59), Expect = 9.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 170 TGHHCRTNVFRTTGHHCR 117 TGHHC TN+ + CR Sbjct: 596 TGHHCETNINECSSQPCR 613 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,618,201 Number of Sequences: 219361 Number of extensions: 1136566 Number of successful extensions: 2240 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2240 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)